SimulationCraft 902-01

for World of Warcraft 9.0.2.36639 Live (wow build level 36639)

Beta Release

Current simulator hotfixes

Death Knight

Tag Spell / Effect Field Hotfixed Value DBC Value
2020-10-25 Incorrect cooldown for Magus of the Dead's Frostbolt.
Frostbolt cooldown 3000.00 0.00
2020-09-20 Incorrect cooldown for Magus of the Dead's Frostbolt.
Frostbolt cooldown 3000.00 0.00

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2018-12-28 Manually set Arcane Orb's travel speed.
Arcane Orb prj_speed 20.00 0.00
2017-06-21 Ice Lance is slower than spell data suggests.
Ice Lance prj_speed 47.00 50.00
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00

Table of Contents

Raid Summary

Additional Raid Information

Kyrian_Forgelite : 8534 dps, 3781 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
8534.2 8534.2 11.2 / 0.131% 813.8 / 9.5% 3.9
RPS Out RPS In Primary Resource Waiting APM Active Skill
2153.5 2049.4 Mana 0.00% 53.3 100.0% 100%
Talents
Kyrian
Runeforge

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Kyrian_Forgelite 8534
Arcane Barrage 3205 37.6% 58.4 5.14sec 16444 13943 Direct 175.1 4601 9356 5489 18.7%

Stats Details: Arcane Barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 58.45 175.15 0.00 0.00 1.1794 0.0000 961080.12 961080.12 0.00% 13942.84 13942.84
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.35% 142.48 106 179 4601.41 2155 17459 4604.70 4202 5123 655512 655512 0.00%
crit 18.65% 32.67 15 55 9356.11 4309 34919 9360.50 6042 13268 305568 305568 0.00%

Action Details: Arcane Barrage

  • id:44425
  • school:arcane
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.728000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=0 + 72.8%} Arcane damage. For each Arcane Charge, deals {$36032s2=30}% additional damage$?a321526[, grants you {$321526s1=2}% of your maximum mana,][]$?a231564[ and hits {$36032s3=0} additional nearby $Ltarget:targets; for {$s2=40}% of its damage][]. |cFFFFFFFFConsumes all Arcane Charges.|r

Action Priority List

    aoe
    [r]:58.44
  • if_expr:buff.arcane_charge.stack=buff.arcane_charge.max_stack
Arcane Explosion 3704 43.4% 159.8 1.85sec 6950 5988 Direct 479.5 1940 3966 2317 18.6%

Stats Details: Arcane Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 159.83 479.50 0.00 0.00 1.1608 0.0000 1110905.77 1110905.77 0.00% 5987.71 5987.71
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.37% 390.16 296 499 1939.65 1427 5397 1940.45 1831 2063 756627 756627 0.00%
crit 18.63% 89.34 51 139 3966.45 2855 10794 3966.80 3418 4535 354279 354279 0.00%

Action Details: Arcane Explosion

  • id:1449
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.502320
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s2=0 + 50.2%} Arcane damage to all enemies within $A2 yards.$?a137021[ |cFFFFFFFFGenerates {$s1=1} Arcane Charge if any targets are hit.|r][]

Action Priority List

    aoe
    [q]:159.81
  • if_expr:buff.arcane_charge.stack<buff.arcane_charge.max_stack
Arcane Orb 0 (663) 0.0% (7.8%) 13.2 23.44sec 15067 12605

Stats Details: Arcane Orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.19 0.00 0.00 0.00 1.1954 0.0000 0.00 0.00 0.00% 12604.79 12604.79

Action Details: Arcane Orb

  • id:153626
  • school:arcane
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:153626
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r

Action Priority List

    aoe
    [p]:13.19
  • if_expr:buff.arcane_charge.stack=0
    Arcane Orb (_bolt) 663 7.8% 39.5 23.44sec 5031 0 Direct 39.5 4212 8607 5030 18.6%

Stats Details: Arcane Orb Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.51 39.51 0.00 0.00 0.0000 0.0000 198777.50 198777.50 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.36% 32.14 21 44 4211.94 2821 8381 4212.58 3428 4798 135357 135357 0.00%
crit 18.64% 7.37 1 17 8606.92 5642 16761 8629.73 5642 14806 63420 63420 0.00%

Action Details: Arcane Orb Bolt

  • id:153640
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.092000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:153640
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:{$@spelldesc153626=Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r}
Deathly Fixation 0 (86) 0.0% (1.0%) 18.6 1.34sec 1379 0

Stats Details: Deathly Fixation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.55 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Deathly Fixation

  • id:322253
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:42.90
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322253
  • name:Deathly Fixation
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1.
  • description:Deal {$s1=43} Shadow damage every $t1. Stacks up to 5 times.
    Deathly Eruption 86 1.0% 18.6 1.34sec 1379 0 Direct 18.6 1137 2275 1379 21.3%

Stats Details: Deathly Eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.55 18.55 0.00 0.00 0.0000 0.0000 25585.22 25585.22 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.74% 14.61 7 25 1137.31 1117 1184 1137.30 1117 1184 16612 16612 0.00%
crit 21.26% 3.94 0 10 2275.29 2233 2367 2235.71 0 2367 8974 8974 0.00%

Action Details: Deathly Eruption

  • id:322256
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:984.99
  • base_dd_max:984.99
  • base_dd_mult:1.00

Spelldata

  • id:322256
  • name:Deathly Eruption
  • school:shadow
  • tooltip:
  • description:Deal {$s1=985} Shadow damage.
Eternal Insight 39 0.5% 21.2 13.88sec 551 0 Direct 21.2 464 928 552 18.9%

Stats Details: Eternal Insight

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 21.21 21.21 0.00 0.00 0.0000 0.0000 11695.22 11695.22 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.11% 17.20 7 30 463.78 453 481 463.76 453 476 7978 7978 0.00%
crit 18.89% 4.01 0 11 927.88 907 961 912.48 0 961 3717 3717 0.00%

Action Details: Eternal Insight

  • id:342314
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:400.00
  • base_dd_max:400.00
  • base_dd_mult:1.00

Spelldata

  • id:342314
  • name:Eternal Insight
  • school:shadow
  • tooltip:
  • description:Deals {$s1=400} Shadow damage.
Frostbolt 4 0.0% 0.0 0.00sec 0 0 Direct 1.0 1024 2047 1185 15.6%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 1.00 0.00 0.00 0.0000 0.0000 1183.57 1183.57 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.38% 0.84 0 1 1023.69 1024 1024 863.81 0 1024 864 864 0.00%
crit 15.62% 0.16 0 1 2047.39 2047 2047 319.76 0 2047 320 320 0.00%

Action Details: Frostbolt

  • id:116
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.511000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116
  • name:Frostbolt
  • school:frost
  • tooltip:
  • description:Launches a bolt of frost at the enemy, causing {$228597s1=0} Frost damage and slowing movement speed by {$205708s1=50}% for {$205708d=8 seconds}.
Mirror Image 0 (19) 0.0% (0.2%) 1.0 0.00sec 5748 0

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.
    Frostbolt (mirror_image) 144  / 19 0.2% 117.0 0.99sec 49 49 Direct 117.0 41 83 49 19.8%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 117.00 117.00 0.00 0.00 1.0091 0.0000 5747.84 5747.84 0.00% 48.68 48.68
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.24% 93.88 78 107 40.86 30 51 40.86 40 43 3836 3836 0.00%
crit 19.76% 23.12 10 39 82.69 59 101 82.71 69 93 1912 1912 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:40.00
Radiant Spark 143 1.7% 9.1 34.50sec 4738 3871 Direct 9.1 2425 4981 2894 18.4%
Periodic 63.0 223 449 265 18.7% 9.9%

Stats Details: Radiant Spark

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.07 9.07 62.99 62.99 1.2241 1.4130 42957.53 42957.53 0.00% 429.14 3871.09
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.62% 7.40 3 11 2425.27 1963 5302 2422.13 1963 3207 17937 17937 0.00%
crit 18.38% 1.67 0 6 4981.32 3926 10005 4162.57 0 10005 8305 8305 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 81.33% 51.23 36 69 223.16 54 446 223.20 187 277 11436 11436 0.00%
crit 18.67% 11.76 3 23 449.11 108 892 448.16 310 717 5280 5280 0.00%

Action Details: Radiant Spark

  • id:307443
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.760000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.082400
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:10.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:307443
  • name:Radiant Spark
  • school:arcane
  • tooltip:Suffering $w2 Arcane damage every $t2 sec.
  • description:Conjure a radiant spark that causes {$s1=0 + 76.0%} Arcane damage instantly, and an additional $o2 damage over {$d=10 seconds}. The target takes {$307454s1=10}% increased damage from your direct damage spells, stacking each time they are struck. This effect ends after {$307454u=4} spells.

Action Priority List

    aoe
    [j]:5.67
  • if_expr:cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
    aoe
    [k]:3.33
  • if_expr:cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
    aoe
    [l]:0.10
  • if_expr:cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
Touch of the Magi 0 (658) 0.0% (7.7%) 6.1 52.45sec 32227 26874

Stats Details: Touch Of The Magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.13 0.00 0.00 0.00 1.1992 0.0000 0.00 0.00 0.00% 26874.12 26874.12

Action Details: Touch Of The Magi

  • id:321507
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:4.0

Spelldata

  • id:321507
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]

Action Priority List

    aoe
    [m]:6.14
  • if_expr:buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
    Touch of the Magi (_explosion) 658 7.7% 6.1 52.35sec 32227 0 Direct 18.4 10755 0 10755 0.0%

Stats Details: Touch Of The Magi Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.13 18.35 0.00 0.00 0.0000 0.0000 197390.41 197390.41 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 18.35 15 21 10754.56 32 49182 10744.11 8252 13596 197390 197390 0.00%

Action Details: Touch Of The Magi Explosion

  • id:210833
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:12432.05
  • base_dd_max:12432.05
  • base_dd_mult:1.00

Spelldata

  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc321507=Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]}
pet - bron 57 / 12
melee 57 0.1% 20.8 8.36sec 171 133 Direct 20.8 148 295 171 16.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 20.77 20.77 0.00 0.00 1.2878 0.0000 3558.46 5082.91 29.99% 133.04 133.04
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.99% 17.45 11 28 147.68 135 189 147.69 135 160 2576 3680 29.99%
crit 16.01% 3.33 0 10 295.34 271 379 287.01 0 379 982 1403 29.13%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Simple Action Stats Execute Interval
Kyrian_Forgelite
Arcane Power 2.8 128.84sec

Stats Details: Arcane Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.84 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Power

  • id:12042
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].

Action Priority List

    aoe
    [n]:2.84
  • if_expr:((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
Berserking 1.8 258.08sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.84 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    shared_cds
    [x]:1.84
  • if_expr:buff.arcane_power.up
Conjure Mana Gem 1.0 0.00sec

Stats Details: Conjure Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Conjure Mana Gem

  • id:759
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:9000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:759
  • name:Conjure Mana Gem
  • school:arcane
  • tooltip:
  • description:Conjures a Mana Gem that can be used to instantly restore {$5405s1=10}% mana, and holds up to {$s2=3} charges. $@spellname118812 {$@spelldesc118812=Conjured items disappear if logged out for more than 15 minutes.}
Evocation 1.0 221.06sec

Stats Details: Evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.99 0.00 5.85 0.00 4.1757 0.7019 0.00 0.00 0.00% 0.00 0.00

Action Details: Evocation

  • id:12051
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Kyrian_Forgelite
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.

Action Priority List

    aoe
    [s]:0.99
  • interrupt_if_expr:mana.pct>=85
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Kyrian_Forgelite
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Kyrian_Forgelite
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Deathly Fixation (potion) 1.0 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307497
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    shared_cds
    [v]:1.00
  • if_expr:buff.arcane_power.up
Rune of Power 6.0 51.32sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.97 0.00 0.00 0.00 1.1971 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    aoe
    [o]:6.00
  • if_expr:buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Time Warp 1.5 300.61sec

Stats Details: Time Warp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.49 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Time Warp

  • id:80353
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:2000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:80353
  • name:Time Warp
  • school:arcane
  • tooltip:Haste increased by $w1%. $?$W4>0[Time rate increased by $w4%.][]$?$W3=1[ When the effect ends, you die.][]
  • description:Warp the flow of time, increasing haste by {$s1=30}% $?a320919[and time rate by {$s4=0}% ][]for all party and raid members for {$d=40 seconds}. Allies will be unable to benefit from Bloodlust, Heroism, or Time Warp again for {$57724d=600 seconds}.$?a320920[ When the effect ends, you die.][]

Action Priority List

    shared_cds
    [w]:1.48
  • if_expr:runeforge.temporal_warp.equipped&buff.exhaustion.up
Replenish Mana (use_mana_gem) 2.8 124.52sec

Stats Details: Use Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.76 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Use Mana Gem

  • id:5405
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Kyrian_Forgelite
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5405
  • name:Replenish Mana
  • school:physical
  • tooltip:Restoring $w2 mana every $t1 sec.
  • description:Restores {$s1=10}% mana.

Action Priority List

    shared_cds
    [t]:2.77
  • if_expr:(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
pet - bron
Anima Cannon 8.3 22.73sec

Stats Details: Anima Cannon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.26 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Anima Cannon

  • id:332525
  • school:arcane
  • range:100.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:8.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:332525
  • name:Anima Cannon
  • school:arcane
  • tooltip:
  • description:{$@spelldesc333950=After using ${{$332514u=89}+1} damaging or healing spells and abilities, your next spell or ability summons Bron, who knocks enemies back on arrival and then attacks and heals your targets for {$333961d=30 seconds}.}

Action Priority List

    default
    [ ]:8.25
Vitalizing Bolt (goliath_support) 14.5 12.30sec

Stats Details: Goliath Support

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 14.46 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Goliath Support

  • id:332526
  • school:arcane
  • range:100.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:4.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Kyrian_Forgelite_bron
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:332526
  • name:Vitalizing Bolt
  • school:arcane
  • tooltip:
  • description:{$@spelldesc333950=After using ${{$332514u=89}+1} damaging or healing spells and abilities, your next spell or ability summons Bron, who knocks enemies back on arrival and then attacks and heals your targets for {$333961d=30 seconds}.}

Action Priority List

    default
    [ ]:14.46
Smash 8.2 22.72sec

Stats Details: Smash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.22 0.00 0.00 0.00 2.1482 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Smash

  • id:341163
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:3.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:6.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:341163
  • name:Smash
  • school:physical
  • tooltip:
  • description:Attacks the ground with a heavy smash, inflicting Arcane damage to all enemies in a cone in front of the caster.

Action Priority List

    default
    [ ]:8.29

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Arcane Charge 59.2 159.4 5.1sec 1.4sec 3.7sec 72.76% 0.00% 1.1 (1.3) 0.0

Buff Details

  • buff initial source:Kyrian_Forgelite
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.8s / 13.4s
  • trigger_min/max:0.0s / 8.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.9s

Stack Uptimes

  • arcane_charge_1:19.79%
  • arcane_charge_2:16.28%
  • arcane_charge_3:15.99%
  • arcane_charge_4:20.69%

Spelldata

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 2.8 0.0 128.8sec 128.8sec 14.7sec 13.89% 0.00% 0.0 (0.0) 2.7

Buff Details

  • buff initial source:Kyrian_Forgelite
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:121.4s / 137.2s
  • trigger_min/max:121.4s / 137.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • arcane_power_1:13.89%

Spelldata

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Berserking 1.8 0.0 258.1sec 258.1sec 11.7sec 7.11% 12.60% 0.0 (0.0) 1.7

Buff Details

  • buff initial source:Kyrian_Forgelite
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:247.7s / 263.8s
  • trigger_min/max:247.7s / 263.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • berserking_1:7.11%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.51% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Kyrian_Forgelite
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.51%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bron's Call to Action 3.2 234.8 110.9sec 1.3sec 93.1sec 99.06% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Kyrian_Forgelite
  • cooldown name:buff_brons_call_to_action
  • max_stacks:89
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:94.6s / 129.2s
  • trigger_min/max:0.1s / 6.9s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 127.9s

Stack Uptimes

  • brons_call_to_action_1:1.37%
  • brons_call_to_action_2:1.19%
  • brons_call_to_action_3:1.22%
  • brons_call_to_action_4:1.23%
  • brons_call_to_action_5:1.18%
  • brons_call_to_action_6:1.35%
  • brons_call_to_action_7:1.23%
  • brons_call_to_action_8:1.31%
  • brons_call_to_action_9:1.27%
  • brons_call_to_action_10:1.19%
  • brons_call_to_action_11:1.44%
  • brons_call_to_action_12:1.39%
  • brons_call_to_action_13:1.18%
  • brons_call_to_action_14:1.21%
  • brons_call_to_action_15:1.14%
  • brons_call_to_action_16:1.14%
  • brons_call_to_action_17:1.25%
  • brons_call_to_action_18:1.11%
  • brons_call_to_action_19:1.38%
  • brons_call_to_action_20:1.12%
  • brons_call_to_action_21:1.10%
  • brons_call_to_action_22:1.10%
  • brons_call_to_action_23:1.12%
  • brons_call_to_action_24:1.16%
  • brons_call_to_action_25:1.08%
  • brons_call_to_action_26:1.26%
  • brons_call_to_action_27:1.06%
  • brons_call_to_action_28:1.08%
  • brons_call_to_action_29:1.11%
  • brons_call_to_action_30:1.06%
  • brons_call_to_action_31:1.24%
  • brons_call_to_action_32:1.01%
  • brons_call_to_action_33:1.01%
  • brons_call_to_action_34:1.22%
  • brons_call_to_action_35:1.11%
  • brons_call_to_action_36:1.01%
  • brons_call_to_action_37:1.02%
  • brons_call_to_action_38:1.14%
  • brons_call_to_action_39:1.36%
  • brons_call_to_action_40:1.06%
  • brons_call_to_action_41:0.98%
  • brons_call_to_action_42:0.98%
  • brons_call_to_action_43:1.21%
  • brons_call_to_action_44:0.97%
  • brons_call_to_action_45:1.00%
  • brons_call_to_action_46:0.96%
  • brons_call_to_action_47:0.98%
  • brons_call_to_action_48:1.16%
  • brons_call_to_action_49:0.94%
  • brons_call_to_action_50:0.94%
  • brons_call_to_action_51:0.93%
  • brons_call_to_action_52:1.15%
  • brons_call_to_action_53:1.25%
  • brons_call_to_action_54:1.14%
  • brons_call_to_action_55:1.12%
  • brons_call_to_action_56:1.08%
  • brons_call_to_action_57:1.29%
  • brons_call_to_action_58:1.08%
  • brons_call_to_action_59:1.04%
  • brons_call_to_action_60:1.03%
  • brons_call_to_action_61:1.02%
  • brons_call_to_action_62:1.06%
  • brons_call_to_action_63:1.02%
  • brons_call_to_action_64:1.05%
  • brons_call_to_action_65:1.44%
  • brons_call_to_action_66:1.01%
  • brons_call_to_action_67:1.01%
  • brons_call_to_action_68:1.00%
  • brons_call_to_action_69:1.01%
  • brons_call_to_action_70:1.08%
  • brons_call_to_action_71:1.00%
  • brons_call_to_action_72:1.41%
  • brons_call_to_action_73:0.99%
  • brons_call_to_action_74:0.99%
  • brons_call_to_action_75:1.01%
  • brons_call_to_action_76:1.02%
  • brons_call_to_action_77:1.02%
  • brons_call_to_action_78:1.00%
  • brons_call_to_action_79:1.19%
  • brons_call_to_action_80:1.04%
  • brons_call_to_action_81:1.09%
  • brons_call_to_action_82:1.06%
  • brons_call_to_action_83:0.97%
  • brons_call_to_action_84:1.14%
  • brons_call_to_action_85:1.00%
  • brons_call_to_action_86:1.02%
  • brons_call_to_action_87:1.07%
  • brons_call_to_action_88:0.95%
  • brons_call_to_action_89:0.97%

Spelldata

  • id:332514
  • name:Bron's Call to Action
  • tooltip:Bron arrives in ${{$332514u=89}+1-$w1} damaging or healing spells or abilities.
  • description:{$@spelldesc333950=After using ${{$332514u=89}+1} damaging or healing spells and abilities, your next spell or ability summons Bron, who knocks enemies back on arrival and then attacks and heals your targets for {$333961d=30 seconds}.}
  • max_stacks:89
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Clearcasting 25.5 0.2 11.4sec 11.4sec 1.9sec 16.32% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Kyrian_Forgelite
  • cooldown name:buff_clearcasting
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • clearcasting_1:16.13%
  • clearcasting_2:0.20%
  • clearcasting_3:0.05%

Spelldata

  • id:263725
  • name:Clearcasting
  • tooltip:Your next Arcane Missiles or Arcane Explosion costs no mana{$?s321758=false}[ and Arcane Missiles fires an additional missile][].
  • description:{$@spelldesc79684=For each ${$c*100/{$s1=200}} mana you spend, you have a 1% chance to gain Clearcasting, making your next Arcane Missiles or Arcane Explosion free and channel {$277726s1=20}% faster.$?a321758[ Arcane Missiles fires {$321758s2=1} additional missile.][]}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Crimson Chorus 5.4 0.0 61.1sec 61.1sec 28.6sec 51.62% 0.00% 0.0 (0.0) 4.9

Buff Details

  • buff initial source:Kyrian_Forgelite
  • cooldown name:buff_crimson_chorus
  • max_stacks:3
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:60.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:10.00
  • associated item:Cabalist's Hymnal

Stat Details

  • stat:crit_rating
  • amount:95.00

Trigger Details

  • interval_min/max:60.0s / 65.5s
  • trigger_min/max:60.0s / 65.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • crimson_chorus_1:17.80%
  • crimson_chorus_2:17.20%
  • crimson_chorus_3:16.62%

Spelldata

  • id:344803
  • name:Crimson Chorus
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc344806=Join the Crimson Chorus. Every minute, your Critical Strike swells by ${{$s1=44}*3} over ${{$344803d=10 seconds}*3} sec. before returning to normal. This effect is increased by {$s2=5}% for each member of the Crimson Chorus in your party.}
  • max_stacks:3
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Evocation 1.0 0.0 227.9sec 227.9sec 4.2sec 1.37% 0.00% 3.9 (3.9) 0.0

Buff Details

  • buff initial source:Kyrian_Forgelite
  • cooldown name:buff_evocation
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:7.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:1.00

Trigger Details

  • interval_min/max:93.7s / 300.9s
  • trigger_min/max:93.7s / 300.9s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 4.3s

Stack Uptimes

  • evocation_1:1.37%

Spelldata

  • id:12051
  • name:Evocation
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Gladiator's Badge 2.8 0.0 128.8sec 128.8sec 14.7sec 13.89% 0.00% 0.0 (0.0) 2.7

Buff Details

  • buff initial source:Kyrian_Forgelite
  • cooldown name:buff_gladiators_badge
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Sinful Aspirant's Badge of Ferocity

Stat Details

  • stat:intellect
  • amount:342.00

Trigger Details

  • interval_min/max:121.4s / 137.2s
  • trigger_min/max:121.4s / 137.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • gladiators_badge_1:13.89%

Spelldata

  • id:345228
  • name:Gladiator's Badge
  • tooltip:Primary stat increased by $w1.
  • description:Increases primary stat by {$s1=252} for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:0.00%
Potion of Deathly Fixation 1.0 0.0 0.0sec 0.0sec 25.0sec 8.45% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Kyrian_Forgelite
  • cooldown name:buff_potion_of_deathly_fixation
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:25.0s / 25.0s

Stack Uptimes

  • potion_of_deathly_fixation_1:8.45%

Spelldata

  • id:307497
  • name:Potion of Deathly Fixation
  • tooltip:Chance to apply Deathly Fixation to your target.
  • description:Your damaging spells and abilities have a chance to apply Deathly Fixation to your target, dealing {$322253s1=43} Shadow damage over {$322253d=8 seconds} and stacking up to 5 times. Upon reaching 5 stacks, Deathly Fixation explodes, dealing {$322256s1=985} Shadow damage to the target. If you consume this potion while your weapon is augmented with Shadowcore Oil, the explosion damage is increased by {$s2=10}%. Lasts {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Rune of Power 8.8 0.0 35.2sec 35.2sec 11.8sec 34.65% 0.00% 0.0 (0.0) 8.5

Buff Details

  • buff initial source:Kyrian_Forgelite
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.6s / 55.0s
  • trigger_min/max:13.6s / 55.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • rune_of_power_1:34.65%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Temporal Warp 1.5 0.0 300.6sec 300.6sec 35.3sec 17.21% 0.00% 0.0 (0.0) 1.1

Buff Details

  • buff initial source:Kyrian_Forgelite
  • cooldown name:buff_temporal_warp
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:300.0s / 301.0s
  • trigger_min/max:300.0s / 301.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 40.0s

Stack Uptimes

  • temporal_warp_1:17.21%

Spelldata

  • id:327355
  • name:Temporal Warp
  • tooltip:Haste increased by $w1%.
  • description:{$@spelldesc327351=While you have Temporal Displacement or other similar effects, you may use Time Warp to grant yourself {$327355s1=30}% Haste for {$327355d=40 seconds}.}
  • max_stacks:0
  • duration:40.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism)

Buff Details

  • buff initial source:Kyrian_Forgelite
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power

Buff Details

  • buff initial source:Kyrian_Forgelite
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Benefit Avg % Min Max
Arcane Barrage Arcane Charge 4 100.00% 100.00% 100.00%
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 1.85% 0.35% 6.56% 0.9s 0.0s 4.7s
Conserve Phase 100.00% 100.00% 100.00% 299.9s 240.2s 360.0s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.0000.0000.000179.943120.203239.964
Evocation135.6733.736349.255226.242145.577353.641
Rune of Power6.6540.10423.13141.51423.48955.288
Touch of the Magi5.3550.68222.45534.62322.18954.290
Arcane Power6.4451.35717.22018.8286.18425.897
Arcane Barrage2.7760.0009.632163.467128.149198.682
Arcane Orb3.3790.00011.72644.85734.13161.101
Radiant Spark2.9380.00024.40928.6127.92649.202
Time Warp1.0690.0001.3031.5911.2962.280

Burn Phases

Burn phase duration tracks the amount of time spent in each burn phase. This is defined as the time between a start_burn_phase and stop_burn_phase action being executed. Note that "execute" burn phases, i.e., the final burn of a fight, is also included.

Burn Phase Duration
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Mana at burn start is the mana level recorded (in percentage of total mana) when a start_burn_phase command is executed.

Mana at Burn Start
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Kyrian_Forgelite
mana_regen Mana 578.71 394467.32 64.17% 681.63 9034.25 2.24%
Evocation Mana 45.87 50169.79 8.16% 1093.71 0.00 0.00%
Mana Gem Mana 2.77 18640.37 3.03% 6736.57 0.00 0.00%
Arcane Barrage Mana 58.44 151397.42 24.63% 2590.69 6073.84 3.86%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 66365.7 2049.37 2153.47 15114.1 36141.8 698.0 67365.7
Usage Type Count Total Avg RPE APR
Kyrian_Forgelite
arcane_explosion Mana 159.8 612211.6 3830.8 3830.4 1.8
arcane_orb Mana 13.2 5955.8 451.5 451.5 33.4
radiant_spark Mana 9.1 8427.3 929.6 929.6 5.1
time_warp Mana 1.5 2969.3 2000.0 1992.1 0.0
touch_of_the_magi Mana 6.1 15271.5 2493.9 2493.3 12.9

Statistics & Data Analysis

Fight Length
Kyrian_Forgelite Fight Length
Count 1319
Mean 299.94
Minimum 240.20
Maximum 359.96
Spread ( max - min ) 119.76
Range [ ( max - min ) / 2 * 100% ] 19.96%
DPS
Kyrian_Forgelite Damage Per Second
Count 1319
Mean 8534.19
Minimum 7915.51
Maximum 9301.19
Spread ( max - min ) 1385.67
Range [ ( max - min ) / 2 * 100% ] 8.12%
Standard Deviation 207.8149
5th Percentile 8198.92
95th Percentile 8890.73
( 95th Percentile - 5th Percentile ) 691.81
Mean Distribution
Standard Deviation 5.7221
95.00% Confidence Interval ( 8522.97 - 8545.40 )
Normalized 95.00% Confidence Interval ( 99.87% - 100.13% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 23
0.1% Error 2278
0.1 Scale Factor Error with Delta=300 369
0.05 Scale Factor Error with Delta=300 1475
0.01 Scale Factor Error with Delta=300 36867
Priority Target DPS
Kyrian_Forgelite Priority Target Damage Per Second
Count 1319
Mean 3780.75
Minimum 3399.14
Maximum 4286.62
Spread ( max - min ) 887.49
Range [ ( max - min ) / 2 * 100% ] 11.74%
Standard Deviation 127.7947
5th Percentile 3577.19
95th Percentile 3995.94
( 95th Percentile - 5th Percentile ) 418.75
Mean Distribution
Standard Deviation 3.5188
95.00% Confidence Interval ( 3773.85 - 3787.64 )
Normalized 95.00% Confidence Interval ( 99.82% - 100.18% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 44
0.1% Error 4390
0.1 Scale Factor Error with Delta=300 140
0.05 Scale Factor Error with Delta=300 558
0.01 Scale Factor Error with Delta=300 13942
DPS(e)
Kyrian_Forgelite Damage Per Second (Effective)
Count 1319
Mean 8534.19
Minimum 7915.51
Maximum 9301.19
Spread ( max - min ) 1385.67
Range [ ( max - min ) / 2 * 100% ] 8.12%
Damage
Kyrian_Forgelite Damage
Count 1319
Mean 2549575.34
Minimum 1955742.26
Maximum 3095238.24
Spread ( max - min ) 1139495.98
Range [ ( max - min ) / 2 * 100% ] 22.35%
DTPS
Kyrian_Forgelite Damage Taken Per Second
Count 1319
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Kyrian_Forgelite Healing Per Second
Count 1319
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Kyrian_Forgelite Healing Per Second (Effective)
Count 1319
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Kyrian_Forgelite Heal
Count 1319
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Kyrian_Forgelite Healing Taken Per Second
Count 1319
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Kyrian_Forgelite Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Kyrian_ForgeliteTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Kyrian_Forgelite Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 variable,name=prepull_evo,op=reset,default=0
1 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
2 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
3 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
4 0.00 variable,name=have_opened,op=reset,default=0
5 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
6 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
7 0.00 variable,name=final_burn,op=set,value=0
8 0.00 variable,name=rs_max_delay,op=reset,default=5
9 0.00 variable,name=ap_max_delay,op=reset,default=10
A 0.00 variable,name=rop_max_delay,op=reset,default=20
B 0.00 variable,name=totm_max_delay,op=reset,default=5
C 0.00 variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
D 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
E 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
F 0.00 variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
G 0.00 variable,name=barrage_mana_pct,op=reset,default=70
H 0.00 variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
I 0.00 variable,name=ap_minimum_mana_pct,op=reset,default=30
J 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
K 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
L 0.00 variable,name=totm_max_charges,op=reset,default=2
M 0.00 variable,name=aoe_totm_max_charges,op=reset,default=2
N 0.00 variable,name=am_spam,op=reset,default=0
O 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
P 0.00 variable,name=am_spam_evo_pct,op=reset,default=15
Q 0.00 flask
R 0.00 food
S 0.00 augmentation
T 0.00 arcane_familiar
U 0.00 arcane_intellect
V 0.00 conjure_mana_gem
W 0.00 snapshot_stats
X 0.00 mirror_image
Y 0.00 frostbolt,if=variable.prepull_evo<=0
Z 0.00 evocation,if=variable.prepull_evo>0
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
a 0.00 call_action_list,name=shared_cds
b 0.00 call_action_list,name=essences
c 0.00 call_action_list,name=aoe,if=active_enemies>2
d 0.00 call_action_list,name=opener,if=variable.have_opened<=0
e 0.00 call_action_list,name=am_spam,if=variable.am_spam=1
f 0.00 call_action_list,name=cooldowns
g 0.00 call_action_list,name=rotation,if=variable.final_burn=0
h 0.00 call_action_list,name=final_burn,if=variable.final_burn=1
i 0.00 call_action_list,name=movement
actions.aoe
# count action,conditions
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
0.00 arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
0.00 mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
j 5.67 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
k 3.33 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
l 0.10 radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
m 6.14 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
n 2.84 arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
o 6.00 rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
0.00 presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
0.00 arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
0.00 supernova
p 13.19 arcane_orb,if=buff.arcane_charge.stack=0
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
q 159.81 arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
0.00 arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
r 58.44 arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
s 0.99 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.shared_cds
# count action,conditions
t 2.77 use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
u 2.84 use_items,if=buff.arcane_power.up
v 1.00 potion,if=buff.arcane_power.up
w 1.48 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
0.00 lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
x 1.84 berserking,if=buff.arcane_power.up
0.00 blood_fury,if=buff.arcane_power.up
0.00 fireblood,if=buff.arcane_power.up
0.00 ancestral_call,if=buff.arcane_power.up

Sample Sequence

045789ABGILMNPQRVXYkwmnuvxrprqqqqrqqqqrqqqqorqqqqrqtqqqrprqqqqrqqjqqrqqqqrqqqqrqqqqrprqqqqrqmorqqqqrjprqqqqrqqqqrqqsqqrprqqqqrkmorqqqqrprqqqqnurqqqqrqqqqrjprqqqqtrqqqqrmorqqqqrprqjqqqrqqqqrqqqqrprqqqqrqqqqrkmorprqqqqrqqqqrqqqqrprqjqqqrqqqqrqqqqrmnuxrprqqqqrqtjqqqorqqqqrprqqqqrqqqqrqqwqqrprqqqqrqqqqrqqqqrkmorprqqqqrqqqqrqqqqrqqqqrp

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 prepull_evo Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat 4 have_opened Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat 5 have_opened Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat 7 final_burn Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat 8 rs_max_delay Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat 9 ap_max_delay Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat A rop_max_delay Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat B totm_max_delay Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat G barrage_mana_pct Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat I ap_minimum_mana_pct Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat L totm_max_charges Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat M aoe_totm_max_charges Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat N am_spam Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat P am_spam_evo_pct Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat Q flask Kyrian_Forgelite 67365.7/67366: 100% mana
Pre precombat R food Kyrian_Forgelite 67365.7/67366: 100% mana
Pre precombat V conjure_mana_gem Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat X mirror_image Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat Y frostbolt Fluffy_Pillow 67365.7/67366: 100% mana
0:00.000 aoe k radiant_spark Fluffy_Pillow 66365.7/67366: 99% mana clearcasting
0:01.300 shared_cds w time_warp Fluffy_Pillow 66372.5/67366: 99% mana bloodlust, clearcasting, crimson_chorus
0:01.300 aoe m touch_of_the_magi Fluffy_Pillow 64372.5/67366: 96% mana bloodlust, clearcasting, temporal_warp, crimson_chorus
0:02.071 aoe n arcane_power Fluffy_Pillow 62911.2/67366: 93% mana bloodlust, arcane_charge(4), clearcasting, temporal_warp, crimson_chorus
0:02.071 shared_cds u use_items Fluffy_Pillow 62911.2/67366: 93% mana bloodlust, arcane_charge(4), arcane_power, clearcasting, rune_of_power, temporal_warp, crimson_chorus
0:02.071 shared_cds v potion Fluffy_Pillow 62911.2/67366: 93% mana bloodlust, arcane_charge(4), arcane_power, clearcasting, rune_of_power, temporal_warp, crimson_chorus, gladiators_badge
0:02.071 shared_cds x berserking Fluffy_Pillow 62911.2/67366: 93% mana bloodlust, arcane_charge(4), arcane_power, clearcasting, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:02.071 aoe r arcane_barrage Fluffy_Pillow 62911.2/67366: 93% mana bloodlust, berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:02.826 aoe p arcane_orb Fluffy_Pillow 66623.1/67366: 99% mana bloodlust, berserking, arcane_power, clearcasting, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:03.581 aoe r arcane_barrage Fluffy_Pillow 67365.7/67366: 100% mana bloodlust, berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:04.337 aoe q arcane_explosion Fluffy_Pillow 67365.7/67366: 100% mana bloodlust, berserking, arcane_power, clearcasting, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:05.090 aoe q arcane_explosion Fluffy_Pillow 67365.7/67366: 100% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:05.844 aoe q arcane_explosion Fluffy_Pillow 65881.6/67366: 98% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:06.599 aoe q arcane_explosion Fluffy_Pillow 64398.8/67366: 96% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:07.354 aoe r arcane_barrage Fluffy_Pillow 62916.0/67366: 93% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:08.108 aoe q arcane_explosion Fluffy_Pillow 66626.5/67366: 99% mana bloodlust, berserking, arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:08.861 aoe q arcane_explosion Fluffy_Pillow 65141.1/67366: 97% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:09.616 aoe q arcane_explosion Fluffy_Pillow 63658.3/67366: 94% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:10.370 aoe q arcane_explosion Fluffy_Pillow 62174.2/67366: 92% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:11.123 aoe r arcane_barrage Fluffy_Pillow 60688.7/67366: 90% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:11.880 aoe q arcane_explosion Fluffy_Pillow 64403.2/67366: 96% mana bloodlust, berserking, arcane_power, rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:12.635 aoe q arcane_explosion Fluffy_Pillow 62920.5/67366: 93% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:13.389 aoe q arcane_explosion Fluffy_Pillow 61436.3/67366: 91% mana bloodlust, berserking, arcane_charge(2), arcane_power, clearcasting, rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:14.145 aoe q arcane_explosion Fluffy_Pillow 62454.9/67366: 93% mana bloodlust, arcane_charge(3), arcane_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:14.917 aoe o rune_of_power Fluffy_Pillow 60995.0/67366: 91% mana bloodlust, arcane_charge(4), arcane_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:15.687 aoe r arcane_barrage Fluffy_Pillow 62032.5/67366: 92% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:16.458 aoe q arcane_explosion Fluffy_Pillow 65765.9/67366: 98% mana bloodlust, arcane_power, rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:17.229 aoe q arcane_explosion Fluffy_Pillow 64304.6/67366: 95% mana bloodlust, arcane_charge, rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation
0:18.000 aoe q arcane_explosion Fluffy_Pillow 60343.4/67366: 90% mana bloodlust, arcane_charge(2), clearcasting, rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation
0:18.771 aoe q arcane_explosion Fluffy_Pillow 61382.2/67366: 91% mana bloodlust, arcane_charge(3), rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation
0:19.542 aoe r arcane_barrage Fluffy_Pillow 57421.0/67366: 85% mana bloodlust, arcane_charge(4), rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation
0:20.313 aoe q arcane_explosion Fluffy_Pillow 61154.4/67366: 91% mana bloodlust, rune_of_power, temporal_warp, crimson_chorus(3), potion_of_deathly_fixation
0:21.082 shared_cds t use_mana_gem Kyrian_Forgelite 57190.5/67366: 85% mana bloodlust, arcane_charge, rune_of_power, temporal_warp, crimson_chorus(3), potion_of_deathly_fixation
0:21.082 aoe q arcane_explosion Fluffy_Pillow 63927.1/67366: 95% mana bloodlust, arcane_charge, rune_of_power, temporal_warp, crimson_chorus(3), potion_of_deathly_fixation
0:21.852 aoe q arcane_explosion Fluffy_Pillow 59964.5/67366: 89% mana bloodlust, arcane_charge(2), rune_of_power, temporal_warp, crimson_chorus(3), potion_of_deathly_fixation
0:22.622 aoe q arcane_explosion Fluffy_Pillow 56001.9/67366: 83% mana bloodlust, arcane_charge(3), rune_of_power, temporal_warp, crimson_chorus(3), potion_of_deathly_fixation
0:23.393 aoe r arcane_barrage Fluffy_Pillow 52040.7/67366: 77% mana bloodlust, arcane_charge(4), rune_of_power, temporal_warp, crimson_chorus(3), potion_of_deathly_fixation
0:24.163 aoe p arcane_orb Fluffy_Pillow 55772.8/67366: 83% mana bloodlust, rune_of_power, temporal_warp, crimson_chorus(3), potion_of_deathly_fixation
0:24.933 aoe r arcane_barrage Fluffy_Pillow 56310.2/67366: 84% mana bloodlust, arcane_charge(4), rune_of_power, temporal_warp, crimson_chorus(3), potion_of_deathly_fixation
0:25.703 aoe q arcane_explosion Fluffy_Pillow 60042.2/67366: 89% mana bloodlust, rune_of_power, temporal_warp, crimson_chorus(3), potion_of_deathly_fixation
0:26.472 aoe q arcane_explosion Fluffy_Pillow 56078.3/67366: 83% mana bloodlust, arcane_charge, rune_of_power, temporal_warp, crimson_chorus(3), potion_of_deathly_fixation
0:27.243 aoe q arcane_explosion Fluffy_Pillow 52117.1/67366: 77% mana bloodlust, arcane_charge(2), rune_of_power, temporal_warp, crimson_chorus(3)
0:28.015 aoe q arcane_explosion Fluffy_Pillow 48157.2/67366: 71% mana bloodlust, arcane_charge(3), temporal_warp, crimson_chorus(3)
0:28.785 aoe r arcane_barrage Fluffy_Pillow 44194.7/67366: 66% mana bloodlust, arcane_charge(4), temporal_warp, crimson_chorus(3)
0:29.555 aoe q arcane_explosion Fluffy_Pillow 47926.7/67366: 71% mana bloodlust, temporal_warp, crimson_chorus(3)
0:30.325 aoe q arcane_explosion Fluffy_Pillow 43964.2/67366: 65% mana bloodlust, arcane_charge, temporal_warp
0:31.096 aoe j radiant_spark Fluffy_Pillow 40002.9/67366: 59% mana bloodlust, arcane_charge(2), temporal_warp
0:32.066 aoe q arcane_explosion Fluffy_Pillow 40309.8/67366: 60% mana bloodlust, arcane_charge(2), temporal_warp
0:32.837 aoe q arcane_explosion Fluffy_Pillow 36348.6/67366: 54% mana bloodlust, arcane_charge(3), temporal_warp
0:33.608 aoe r arcane_barrage Fluffy_Pillow 32387.4/67366: 48% mana bloodlust, arcane_charge(4), temporal_warp
0:34.376 aoe q arcane_explosion Fluffy_Pillow 36116.8/67366: 54% mana bloodlust, temporal_warp
0:35.147 aoe q arcane_explosion Fluffy_Pillow 32155.5/67366: 48% mana bloodlust, arcane_charge, clearcasting, temporal_warp
0:35.917 aoe q arcane_explosion Fluffy_Pillow 33193.0/67366: 49% mana bloodlust, arcane_charge(2), temporal_warp
0:36.686 aoe q arcane_explosion Fluffy_Pillow 29229.1/67366: 43% mana bloodlust, arcane_charge(3), temporal_warp
0:37.455 aoe r arcane_barrage Fluffy_Pillow 25265.1/67366: 38% mana bloodlust, arcane_charge(4), temporal_warp
0:38.225 aoe q arcane_explosion Fluffy_Pillow 28997.2/67366: 43% mana bloodlust, temporal_warp
0:38.995 aoe q arcane_explosion Fluffy_Pillow 25034.6/67366: 37% mana bloodlust, arcane_charge, temporal_warp
0:39.766 aoe q arcane_explosion Fluffy_Pillow 21073.4/67366: 31% mana bloodlust, arcane_charge(2), temporal_warp
0:40.535 aoe q arcane_explosion Fluffy_Pillow 17109.5/67366: 25% mana bloodlust, arcane_charge(3), clearcasting, temporal_warp
0:41.306 aoe r arcane_barrage Fluffy_Pillow 18148.3/67366: 27% mana arcane_charge(4)
0:42.605 aoe q arcane_explosion Fluffy_Pillow 22593.1/67366: 34% mana
0:43.905 aoe q arcane_explosion Fluffy_Pillow 19344.6/67366: 29% mana arcane_charge
0:45.206 aoe q arcane_explosion Fluffy_Pillow 16097.4/67366: 24% mana arcane_charge(2)
0:46.505 aoe q arcane_explosion Fluffy_Pillow 12847.6/67366: 19% mana arcane_charge(3)
0:47.804 aoe r arcane_barrage Fluffy_Pillow 9597.8/67366: 14% mana arcane_charge(4), clearcasting
0:49.103 aoe p arcane_orb Fluffy_Pillow 14042.5/67366: 21% mana clearcasting
0:50.402 aoe r arcane_barrage Fluffy_Pillow 15292.7/67366: 23% mana arcane_charge(4), clearcasting(2)
0:51.701 aoe q arcane_explosion Fluffy_Pillow 19737.5/67366: 29% mana clearcasting(2)
0:53.003 aoe q arcane_explosion Fluffy_Pillow 21491.7/67366: 32% mana arcane_charge, clearcasting
0:54.301 aoe q arcane_explosion Fluffy_Pillow 23240.5/67366: 34% mana arcane_charge(2)
0:55.599 aoe q arcane_explosion Fluffy_Pillow 19989.3/67366: 30% mana arcane_charge(3)
0:56.898 aoe r arcane_barrage Fluffy_Pillow 16739.5/67366: 25% mana arcane_charge(4)
0:58.197 aoe q arcane_explosion Fluffy_Pillow 21184.3/67366: 31% mana
0:59.497 aoe m touch_of_the_magi Fluffy_Pillow 17935.8/67366: 27% mana arcane_charge
1:00.796 aoe o rune_of_power Fluffy_Pillow 17185.9/67366: 26% mana arcane_charge(4)
1:02.096 aoe r arcane_barrage Fluffy_Pillow 18937.5/67366: 28% mana arcane_charge(4), rune_of_power
1:03.397 aoe q arcane_explosion Fluffy_Pillow 23384.9/67366: 35% mana rune_of_power, crimson_chorus
1:04.697 aoe q arcane_explosion Fluffy_Pillow 20136.4/67366: 30% mana arcane_charge, rune_of_power, crimson_chorus
1:05.996 aoe q arcane_explosion Fluffy_Pillow 16886.6/67366: 25% mana arcane_charge(2), rune_of_power, crimson_chorus
1:07.297 aoe q arcane_explosion Fluffy_Pillow 13639.5/67366: 20% mana arcane_charge(3), rune_of_power, crimson_chorus
1:08.596 aoe r arcane_barrage Fluffy_Pillow 10389.6/67366: 15% mana arcane_charge(4), rune_of_power, crimson_chorus
1:09.894 aoe j radiant_spark Fluffy_Pillow 14833.1/67366: 22% mana rune_of_power, crimson_chorus
1:11.195 aoe p arcane_orb Fluffy_Pillow 15585.9/67366: 23% mana rune_of_power, crimson_chorus
1:12.495 aoe r arcane_barrage Fluffy_Pillow 16837.4/67366: 25% mana arcane_charge(4), rune_of_power, crimson_chorus
1:13.794 aoe q arcane_explosion Fluffy_Pillow 21282.2/67366: 32% mana rune_of_power, crimson_chorus(2)
1:15.094 aoe q arcane_explosion Fluffy_Pillow 18033.7/67366: 27% mana arcane_charge, crimson_chorus(2)
1:16.392 aoe q arcane_explosion Fluffy_Pillow 14782.5/67366: 22% mana arcane_charge(2), clearcasting, crimson_chorus(2)
1:17.691 aoe q arcane_explosion Fluffy_Pillow 16532.7/67366: 25% mana arcane_charge(3), crimson_chorus(2)
1:18.989 aoe r arcane_barrage Fluffy_Pillow 13281.5/67366: 20% mana arcane_charge(4), crimson_chorus(2)
1:20.290 aoe q arcane_explosion Fluffy_Pillow 17729.0/67366: 26% mana crimson_chorus(2)
1:21.592 aoe q arcane_explosion Fluffy_Pillow 14483.2/67366: 21% mana arcane_charge, crimson_chorus(2)
1:22.891 aoe q arcane_explosion Fluffy_Pillow 11233.4/67366: 17% mana arcane_charge(2), crimson_chorus(3)
1:24.191 aoe q arcane_explosion Fluffy_Pillow 7984.9/67366: 12% mana arcane_charge(3), crimson_chorus(3)
1:25.490 aoe r arcane_barrage Fluffy_Pillow 4735.0/67366: 7% mana arcane_charge(4), crimson_chorus(3)
1:26.788 aoe q arcane_explosion Fluffy_Pillow 9178.5/67366: 14% mana crimson_chorus(3)
1:28.086 aoe q arcane_explosion Fluffy_Pillow 5927.3/67366: 9% mana arcane_charge, crimson_chorus(3)
1:29.384 aoe s evocation Kyrian_Forgelite 2676.1/67366: 4% mana arcane_charge(2), crimson_chorus(3)
1:33.704 aoe q arcane_explosion Fluffy_Pillow 59885.7/67366: 89% mana arcane_charge(2)
1:35.004 aoe q arcane_explosion Fluffy_Pillow 56637.3/67366: 84% mana arcane_charge(3)
1:36.304 aoe r arcane_barrage Fluffy_Pillow 53388.8/67366: 79% mana arcane_charge(4)
1:37.602 aoe p arcane_orb Fluffy_Pillow 57832.2/67366: 86% mana
1:38.902 aoe r arcane_barrage Fluffy_Pillow 59083.7/67366: 88% mana arcane_charge(4)
1:40.203 aoe q arcane_explosion Fluffy_Pillow 63531.2/67366: 94% mana brons_call_to_action
1:41.503 aoe q arcane_explosion Fluffy_Pillow 60282.7/67366: 89% mana arcane_charge, brons_call_to_action(2)
1:42.802 aoe q arcane_explosion Fluffy_Pillow 57032.9/67366: 85% mana arcane_charge(2), brons_call_to_action(3)
1:44.101 aoe q arcane_explosion Fluffy_Pillow 53783.0/67366: 80% mana arcane_charge(3), brons_call_to_action(4)
1:45.398 aoe r arcane_barrage Fluffy_Pillow 50530.5/67366: 75% mana arcane_charge(4), brons_call_to_action(5)
1:46.697 aoe k radiant_spark Fluffy_Pillow 54975.3/67366: 82% mana brons_call_to_action(6)
1:47.995 aoe m touch_of_the_magi Fluffy_Pillow 55724.1/67366: 83% mana brons_call_to_action(7)
1:49.296 aoe o rune_of_power Fluffy_Pillow 54977.0/67366: 82% mana arcane_charge(4), brons_call_to_action(8)
1:50.595 aoe r arcane_barrage Fluffy_Pillow 56727.1/67366: 84% mana arcane_charge(4), rune_of_power, brons_call_to_action(9)
1:51.894 aoe q arcane_explosion Fluffy_Pillow 61171.9/67366: 91% mana rune_of_power, brons_call_to_action(9)
1:53.192 aoe q arcane_explosion Fluffy_Pillow 57920.7/67366: 86% mana arcane_charge, rune_of_power, brons_call_to_action(10)
1:54.492 aoe q arcane_explosion Fluffy_Pillow 54672.2/67366: 81% mana arcane_charge(2), clearcasting, rune_of_power, brons_call_to_action(11)
1:55.791 aoe q arcane_explosion Fluffy_Pillow 56422.4/67366: 84% mana arcane_charge(3), rune_of_power, brons_call_to_action(12)
1:57.090 aoe r arcane_barrage Fluffy_Pillow 53172.6/67366: 79% mana arcane_charge(4), rune_of_power, brons_call_to_action(13)
1:58.388 aoe p arcane_orb Fluffy_Pillow 57616.0/67366: 86% mana rune_of_power, brons_call_to_action(14)
1:59.688 aoe r arcane_barrage Fluffy_Pillow 58867.5/67366: 87% mana arcane_charge(4), rune_of_power, brons_call_to_action(15)
2:00.987 aoe q arcane_explosion Fluffy_Pillow 63312.3/67366: 94% mana rune_of_power, brons_call_to_action(16)
2:02.287 aoe q arcane_explosion Fluffy_Pillow 60063.8/67366: 89% mana arcane_charge, rune_of_power, brons_call_to_action(17)
2:03.587 aoe q arcane_explosion Fluffy_Pillow 56815.3/67366: 84% mana arcane_charge(2), brons_call_to_action(18)
2:04.888 aoe q arcane_explosion Fluffy_Pillow 53568.2/67366: 80% mana arcane_charge(3), crimson_chorus, brons_call_to_action(19)
2:06.189 aoe n arcane_power Fluffy_Pillow 50321.0/67366: 75% mana arcane_charge(4), crimson_chorus, brons_call_to_action(20)
2:06.189 shared_cds u use_items Fluffy_Pillow 50321.0/67366: 75% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus, brons_call_to_action(21)
2:06.189 aoe r arcane_barrage Fluffy_Pillow 50321.0/67366: 75% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus, brons_call_to_action(21), gladiators_badge
2:07.489 aoe q arcane_explosion Fluffy_Pillow 54767.2/67366: 81% mana arcane_power, rune_of_power, crimson_chorus, brons_call_to_action(21), gladiators_badge
2:08.786 aoe q arcane_explosion Fluffy_Pillow 54014.6/67366: 80% mana arcane_charge, arcane_power, rune_of_power, crimson_chorus, brons_call_to_action(22), gladiators_badge
2:10.086 aoe q arcane_explosion Fluffy_Pillow 53266.1/67366: 79% mana arcane_charge(2), arcane_power, rune_of_power, crimson_chorus, brons_call_to_action(23), gladiators_badge
2:11.386 aoe q arcane_explosion Fluffy_Pillow 52517.6/67366: 78% mana arcane_charge(3), arcane_power, rune_of_power, crimson_chorus, brons_call_to_action(24), gladiators_badge
2:12.685 aoe r arcane_barrage Fluffy_Pillow 51767.8/67366: 77% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus, brons_call_to_action(25), gladiators_badge
2:13.986 aoe q arcane_explosion Fluffy_Pillow 56215.3/67366: 83% mana arcane_power, rune_of_power, crimson_chorus(2), brons_call_to_action(26), gladiators_badge
2:15.288 aoe q arcane_explosion Fluffy_Pillow 55469.5/67366: 82% mana arcane_charge, arcane_power, rune_of_power, crimson_chorus(2), brons_call_to_action(27), gladiators_badge
2:16.586 aoe q arcane_explosion Fluffy_Pillow 54718.3/67366: 81% mana arcane_charge(2), arcane_power, rune_of_power, crimson_chorus(2), brons_call_to_action(28), gladiators_badge
2:17.884 aoe q arcane_explosion Fluffy_Pillow 53967.1/67366: 80% mana arcane_charge(3), arcane_power, rune_of_power, crimson_chorus(2), brons_call_to_action(29), gladiators_badge
2:19.184 aoe r arcane_barrage Fluffy_Pillow 53218.6/67366: 79% mana arcane_charge(4), arcane_power, clearcasting, crimson_chorus(2), brons_call_to_action(30), gladiators_badge
2:20.482 aoe j radiant_spark Fluffy_Pillow 57662.1/67366: 86% mana arcane_power, clearcasting, crimson_chorus(2), brons_call_to_action(31), gladiators_badge
2:21.783 aoe p arcane_orb Fluffy_Pillow 58414.9/67366: 87% mana clearcasting, crimson_chorus(2), brons_call_to_action(32)
2:23.082 aoe r arcane_barrage Fluffy_Pillow 59665.1/67366: 89% mana arcane_charge(4), clearcasting, crimson_chorus(2), brons_call_to_action(32)
2:24.380 aoe q arcane_explosion Fluffy_Pillow 64108.5/67366: 95% mana clearcasting, crimson_chorus(3), brons_call_to_action(33)
2:25.680 aoe q arcane_explosion Fluffy_Pillow 65860.0/67366: 98% mana arcane_charge, crimson_chorus(3), brons_call_to_action(34)
2:26.979 aoe q arcane_explosion Fluffy_Pillow 62610.2/67366: 93% mana arcane_charge(2), crimson_chorus(3), brons_call_to_action(35)
2:28.278 aoe q arcane_explosion Fluffy_Pillow 59360.4/67366: 88% mana arcane_charge(3), crimson_chorus(3), brons_call_to_action(36)
2:29.577 shared_cds t use_mana_gem Kyrian_Forgelite 56110.5/67366: 83% mana arcane_charge(4), crimson_chorus(3), brons_call_to_action(37)
2:29.577 aoe r arcane_barrage Fluffy_Pillow 62847.1/67366: 93% mana arcane_charge(4), crimson_chorus(3), brons_call_to_action(37)
2:30.875 aoe q arcane_explosion Fluffy_Pillow 67290.5/67366: 100% mana crimson_chorus(3), brons_call_to_action(38)
2:32.176 aoe q arcane_explosion Fluffy_Pillow 64043.4/67366: 95% mana arcane_charge, clearcasting, crimson_chorus(3), brons_call_to_action(39)
2:33.477 aoe q arcane_explosion Fluffy_Pillow 65796.3/67366: 98% mana arcane_charge(2), crimson_chorus(3), brons_call_to_action(40)
2:34.776 aoe q arcane_explosion Fluffy_Pillow 62546.4/67366: 93% mana arcane_charge(3), brons_call_to_action(41)
2:36.075 aoe r arcane_barrage Fluffy_Pillow 59296.6/67366: 88% mana arcane_charge(4), brons_call_to_action(42)
2:37.374 aoe m touch_of_the_magi Fluffy_Pillow 63741.4/67366: 95% mana brons_call_to_action(43)
2:38.674 aoe o rune_of_power Fluffy_Pillow 62992.9/67366: 94% mana arcane_charge(4), brons_call_to_action(44)
2:39.973 aoe r arcane_barrage Fluffy_Pillow 64743.0/67366: 96% mana arcane_charge(4), rune_of_power, brons_call_to_action(45)
2:41.271 aoe q arcane_explosion Fluffy_Pillow 67365.7/67366: 100% mana rune_of_power, brons_call_to_action(45)
2:42.571 aoe q arcane_explosion Fluffy_Pillow 64117.2/67366: 95% mana arcane_charge, rune_of_power, brons_call_to_action(46)
2:43.870 aoe q arcane_explosion Fluffy_Pillow 60867.4/67366: 90% mana arcane_charge(2), rune_of_power, brons_call_to_action(47)
2:45.169 aoe q arcane_explosion Fluffy_Pillow 57617.5/67366: 86% mana arcane_charge(3), rune_of_power, brons_call_to_action(48)
2:46.468 aoe r arcane_barrage Fluffy_Pillow 54367.7/67366: 81% mana arcane_charge(4), clearcasting, rune_of_power, brons_call_to_action(49)
2:47.769 aoe p arcane_orb Fluffy_Pillow 58815.2/67366: 87% mana clearcasting, rune_of_power, brons_call_to_action(50)
2:49.069 aoe r arcane_barrage Fluffy_Pillow 60066.7/67366: 89% mana arcane_charge(4), clearcasting, rune_of_power, brons_call_to_action(51)
2:50.369 aoe q arcane_explosion Fluffy_Pillow 64512.8/67366: 96% mana clearcasting, rune_of_power, brons_call_to_action(52)
2:51.669 aoe j radiant_spark Fluffy_Pillow 66264.3/67366: 98% mana arcane_charge, rune_of_power, brons_call_to_action(53)
2:53.078 aoe q arcane_explosion Fluffy_Pillow 66373.8/67366: 99% mana arcane_charge, brons_call_to_action(54)
2:54.377 aoe q arcane_explosion Fluffy_Pillow 63124.0/67366: 94% mana arcane_charge(2), clearcasting, brons_call_to_action(54)
2:55.675 aoe q arcane_explosion Fluffy_Pillow 64872.8/67366: 96% mana arcane_charge(3), brons_call_to_action(55)
2:56.976 aoe r arcane_barrage Fluffy_Pillow 61625.6/67366: 91% mana arcane_charge(4), clearcasting, brons_call_to_action(56)
2:58.275 aoe q arcane_explosion Fluffy_Pillow 66070.4/67366: 98% mana clearcasting, brons_call_to_action(57)
2:59.575 aoe q arcane_explosion Fluffy_Pillow 67365.7/67366: 100% mana arcane_charge, brons_call_to_action(58)
3:00.874 aoe q arcane_explosion Fluffy_Pillow 64115.9/67366: 95% mana arcane_charge(2), clearcasting, brons_call_to_action(59)
3:02.172 aoe q arcane_explosion Fluffy_Pillow 65864.7/67366: 98% mana arcane_charge(3), brons_call_to_action(60)
3:03.472 aoe r arcane_barrage Fluffy_Pillow 62616.2/67366: 93% mana arcane_charge(4), brons_call_to_action(61)
3:04.772 aoe q arcane_explosion Fluffy_Pillow 67062.3/67366: 100% mana crimson_chorus, brons_call_to_action(62)
3:06.071 aoe q arcane_explosion Fluffy_Pillow 63812.5/67366: 95% mana arcane_charge, clearcasting, crimson_chorus, brons_call_to_action(63)
3:07.372 aoe q arcane_explosion Fluffy_Pillow 65565.4/67366: 97% mana arcane_charge(2), crimson_chorus, brons_call_to_action(64)
3:08.671 aoe q arcane_explosion Fluffy_Pillow 62315.5/67366: 93% mana arcane_charge(3), crimson_chorus, brons_call_to_action(65)
3:09.970 aoe r arcane_barrage Fluffy_Pillow 59065.7/67366: 88% mana arcane_charge(4), crimson_chorus, brons_call_to_action(66)
3:11.269 aoe p arcane_orb Fluffy_Pillow 63510.5/67366: 94% mana crimson_chorus, brons_call_to_action(67)
3:12.568 aoe r arcane_barrage Fluffy_Pillow 64760.6/67366: 96% mana arcane_charge(4), clearcasting, crimson_chorus, brons_call_to_action(68)
3:13.868 aoe q arcane_explosion Fluffy_Pillow 67365.7/67366: 100% mana clearcasting, crimson_chorus, brons_call_to_action(69)
3:15.170 aoe q arcane_explosion Fluffy_Pillow 67365.7/67366: 100% mana arcane_charge, crimson_chorus(2), brons_call_to_action(70)
3:16.469 aoe q arcane_explosion Fluffy_Pillow 64115.9/67366: 95% mana arcane_charge(2), crimson_chorus(2), brons_call_to_action(71)
3:17.769 aoe q arcane_explosion Fluffy_Pillow 60867.4/67366: 90% mana arcane_charge(3), crimson_chorus(2), brons_call_to_action(72)
3:19.069 aoe r arcane_barrage Fluffy_Pillow 57618.9/67366: 86% mana arcane_charge(4), crimson_chorus(2), brons_call_to_action(73)
3:20.366 aoe q arcane_explosion Fluffy_Pillow 62061.0/67366: 92% mana crimson_chorus(2), brons_call_to_action(74)
3:21.664 aoe q arcane_explosion Fluffy_Pillow 58809.8/67366: 87% mana arcane_charge, clearcasting, crimson_chorus(2), brons_call_to_action(75)
3:22.964 aoe q arcane_explosion Fluffy_Pillow 60561.3/67366: 90% mana arcane_charge(2), crimson_chorus(2), brons_call_to_action(76)
3:24.265 aoe q arcane_explosion Fluffy_Pillow 57314.2/67366: 85% mana arcane_charge(3), crimson_chorus(3), brons_call_to_action(77)
3:25.564 aoe r arcane_barrage Fluffy_Pillow 54064.3/67366: 80% mana arcane_charge(4), crimson_chorus(3), brons_call_to_action(78)
3:26.863 aoe k radiant_spark Fluffy_Pillow 58509.1/67366: 87% mana crimson_chorus(3), brons_call_to_action(79)
3:28.162 aoe m touch_of_the_magi Fluffy_Pillow 59259.3/67366: 88% mana crimson_chorus(3), brons_call_to_action(80)
3:29.460 aoe o rune_of_power Fluffy_Pillow 58508.1/67366: 87% mana arcane_charge(4), clearcasting, crimson_chorus(3), brons_call_to_action(81)
3:30.761 aoe r arcane_barrage Fluffy_Pillow 60260.9/67366: 89% mana arcane_charge(4), clearcasting, rune_of_power, crimson_chorus(3), brons_call_to_action(82)
3:32.061 aoe p arcane_orb Fluffy_Pillow 64707.1/67366: 96% mana clearcasting, rune_of_power, crimson_chorus(3), brons_call_to_action(82)
3:33.359 aoe r arcane_barrage Fluffy_Pillow 65955.9/67366: 98% mana arcane_charge(4), clearcasting, rune_of_power, crimson_chorus(3), brons_call_to_action(83)
3:34.658 aoe q arcane_explosion Fluffy_Pillow 67365.7/67366: 100% mana clearcasting, rune_of_power, brons_call_to_action(84)
3:35.958 aoe q arcane_explosion Fluffy_Pillow 67365.7/67366: 100% mana arcane_charge, rune_of_power, brons_call_to_action(85)
3:37.259 aoe q arcane_explosion Fluffy_Pillow 64118.6/67366: 95% mana arcane_charge(2), rune_of_power, brons_call_to_action(86)
3:38.558 aoe q arcane_explosion Fluffy_Pillow 60868.7/67366: 90% mana arcane_charge(3), rune_of_power, brons_call_to_action(87)
3:39.858 aoe r arcane_barrage Fluffy_Pillow 57620.2/67366: 86% mana arcane_charge(4), rune_of_power, brons_call_to_action(88)
3:41.158 aoe q arcane_explosion Fluffy_Pillow 62066.4/67366: 92% mana rune_of_power, brons_call_to_action(89)
3:42.456 aoe q arcane_explosion Fluffy_Pillow 58815.2/67366: 87% mana arcane_charge, rune_of_power
3:43.753 aoe q arcane_explosion Fluffy_Pillow 55562.7/67366: 82% mana arcane_charge(2), clearcasting, brons_call_to_action
3:45.051 aoe q arcane_explosion Fluffy_Pillow 57311.5/67366: 85% mana arcane_charge(3), brons_call_to_action(2)
3:46.349 aoe r arcane_barrage Fluffy_Pillow 54060.3/67366: 80% mana arcane_charge(4), brons_call_to_action(3)
3:47.649 aoe q arcane_explosion Fluffy_Pillow 58506.4/67366: 87% mana brons_call_to_action(4)
3:48.949 aoe q arcane_explosion Fluffy_Pillow 55257.9/67366: 82% mana arcane_charge, clearcasting, brons_call_to_action(5)
3:50.247 aoe q arcane_explosion Fluffy_Pillow 57006.7/67366: 85% mana arcane_charge(2), brons_call_to_action(6)
3:51.548 aoe q arcane_explosion Fluffy_Pillow 53759.6/67366: 80% mana arcane_charge(3), brons_call_to_action(7)
3:52.848 aoe r arcane_barrage Fluffy_Pillow 50511.1/67366: 75% mana arcane_charge(4), brons_call_to_action(8)
3:54.146 aoe p arcane_orb Fluffy_Pillow 54954.6/67366: 82% mana brons_call_to_action(9)
3:55.445 aoe r arcane_barrage Fluffy_Pillow 56204.7/67366: 83% mana arcane_charge(4), brons_call_to_action(10)
3:56.744 aoe q arcane_explosion Fluffy_Pillow 60649.5/67366: 90% mana brons_call_to_action(11)
3:58.046 aoe j radiant_spark Fluffy_Pillow 57403.7/67366: 85% mana arcane_charge, brons_call_to_action(12)
3:59.456 aoe q arcane_explosion Fluffy_Pillow 58303.4/67366: 87% mana arcane_charge, brons_call_to_action(13)
4:00.754 aoe q arcane_explosion Fluffy_Pillow 55052.2/67366: 82% mana arcane_charge(2), brons_call_to_action(13)
4:02.053 aoe q arcane_explosion Fluffy_Pillow 51802.4/67366: 77% mana arcane_charge(3), brons_call_to_action(14)
4:03.352 aoe r arcane_barrage Fluffy_Pillow 48552.6/67366: 72% mana arcane_charge(4), brons_call_to_action(15)
4:04.651 aoe q arcane_explosion Fluffy_Pillow 52997.3/67366: 79% mana brons_call_to_action(16)
4:05.951 aoe q arcane_explosion Fluffy_Pillow 49748.9/67366: 74% mana arcane_charge, crimson_chorus, brons_call_to_action(17)
4:07.250 aoe q arcane_explosion Fluffy_Pillow 46499.0/67366: 69% mana arcane_charge(2), crimson_chorus, brons_call_to_action(18)
4:08.549 aoe q arcane_explosion Fluffy_Pillow 43249.2/67366: 64% mana arcane_charge(3), crimson_chorus, brons_call_to_action(19)
4:09.848 aoe r arcane_barrage Fluffy_Pillow 39999.3/67366: 59% mana arcane_charge(4), crimson_chorus, brons_call_to_action(20)
4:11.146 aoe q arcane_explosion Fluffy_Pillow 44442.8/67366: 66% mana crimson_chorus, brons_call_to_action(21)
4:12.445 aoe q arcane_explosion Fluffy_Pillow 41192.9/67366: 61% mana arcane_charge, crimson_chorus, brons_call_to_action(22)
4:13.743 aoe q arcane_explosion Fluffy_Pillow 37941.8/67366: 56% mana arcane_charge(2), crimson_chorus, brons_call_to_action(23)
4:15.043 aoe q arcane_explosion Fluffy_Pillow 34693.3/67366: 51% mana arcane_charge(3), crimson_chorus(2), brons_call_to_action(24)
4:16.343 aoe r arcane_barrage Fluffy_Pillow 31444.8/67366: 47% mana arcane_charge(4), crimson_chorus(2), brons_call_to_action(25)
4:17.643 aoe m touch_of_the_magi Fluffy_Pillow 35890.9/67366: 53% mana crimson_chorus(2), brons_call_to_action(26)
4:18.942 aoe n arcane_power Fluffy_Pillow 35141.1/67366: 52% mana arcane_charge(4), crimson_chorus(2), brons_call_to_action(27)
4:18.942 shared_cds u use_items Fluffy_Pillow 35141.1/67366: 52% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), brons_call_to_action(27)
4:18.942 shared_cds x berserking Fluffy_Pillow 35141.1/67366: 52% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), brons_call_to_action(27), gladiators_badge
4:18.942 aoe r arcane_barrage Fluffy_Pillow 35141.1/67366: 52% mana berserking, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), brons_call_to_action(27), gladiators_badge
4:20.126 aoe p arcane_orb Fluffy_Pillow 39430.9/67366: 59% mana berserking, arcane_power, rune_of_power, crimson_chorus(2), brons_call_to_action(27), gladiators_badge
4:21.309 aoe r arcane_barrage Fluffy_Pillow 40774.8/67366: 61% mana berserking, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), brons_call_to_action(28), gladiators_badge
4:22.491 aoe q arcane_explosion Fluffy_Pillow 45061.9/67366: 67% mana berserking, arcane_power, rune_of_power, crimson_chorus(2), brons_call_to_action(29), gladiators_badge
4:23.674 aoe q arcane_explosion Fluffy_Pillow 44155.8/67366: 66% mana berserking, arcane_charge, arcane_power, rune_of_power, crimson_chorus(2), brons_call_to_action(30), gladiators_badge
4:24.857 aoe q arcane_explosion Fluffy_Pillow 43249.7/67366: 64% mana berserking, arcane_charge(2), arcane_power, rune_of_power, crimson_chorus(3), brons_call_to_action(31), gladiators_badge
4:26.039 aoe q arcane_explosion Fluffy_Pillow 42342.2/67366: 63% mana berserking, arcane_charge(3), arcane_power, rune_of_power, crimson_chorus(3), brons_call_to_action(32), gladiators_badge
4:27.221 aoe r arcane_barrage Fluffy_Pillow 41434.7/67366: 62% mana berserking, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(3), brons_call_to_action(33), gladiators_badge
4:28.404 aoe q arcane_explosion Fluffy_Pillow 45723.2/67366: 68% mana berserking, arcane_power, rune_of_power, crimson_chorus(3), brons_call_to_action(34), gladiators_badge
4:29.588 shared_cds t use_mana_gem Kyrian_Forgelite 44818.5/67366: 67% mana berserking, arcane_charge, arcane_power, rune_of_power, crimson_chorus(3), brons_call_to_action(35), gladiators_badge
4:29.588 aoe j radiant_spark Fluffy_Pillow 51555.0/67366: 77% mana berserking, arcane_charge, arcane_power, rune_of_power, crimson_chorus(3), brons_call_to_action(35), gladiators_badge
4:30.771 aoe q arcane_explosion Fluffy_Pillow 52648.9/67366: 78% mana berserking, arcane_charge, arcane_power, rune_of_power, crimson_chorus(3), brons_call_to_action(36), gladiators_badge
4:31.954 aoe q arcane_explosion Fluffy_Pillow 51742.8/67366: 77% mana arcane_charge(2), arcane_power, crimson_chorus(3), brons_call_to_action(36), gladiators_badge
4:33.253 aoe q arcane_explosion Fluffy_Pillow 50992.9/67366: 76% mana arcane_charge(3), arcane_power, crimson_chorus(3), brons_call_to_action(37), gladiators_badge
4:34.553 aoe o rune_of_power Fluffy_Pillow 50244.5/67366: 75% mana arcane_charge(4), crimson_chorus(3), brons_call_to_action(38)
4:35.852 aoe r arcane_barrage Fluffy_Pillow 51994.6/67366: 77% mana arcane_charge(4), rune_of_power, brons_call_to_action(39)
4:37.153 aoe q arcane_explosion Fluffy_Pillow 56442.1/67366: 84% mana rune_of_power, brons_call_to_action(39)
4:38.452 aoe q arcane_explosion Fluffy_Pillow 53192.3/67366: 79% mana arcane_charge, clearcasting, rune_of_power, brons_call_to_action(40)
4:39.752 aoe q arcane_explosion Fluffy_Pillow 54943.8/67366: 82% mana arcane_charge(2), rune_of_power, brons_call_to_action(41)
4:41.051 aoe q arcane_explosion Fluffy_Pillow 51693.9/67366: 77% mana arcane_charge(3), rune_of_power, brons_call_to_action(42)
4:42.349 aoe r arcane_barrage Fluffy_Pillow 48442.7/67366: 72% mana arcane_charge(4), rune_of_power, brons_call_to_action(43)
4:43.647 aoe p arcane_orb Fluffy_Pillow 52886.2/67366: 79% mana rune_of_power, brons_call_to_action(44)
4:44.947 aoe r arcane_barrage Fluffy_Pillow 54137.7/67366: 80% mana arcane_charge(4), rune_of_power, brons_call_to_action(45)
4:46.248 aoe q arcane_explosion Fluffy_Pillow 58585.2/67366: 87% mana rune_of_power, brons_call_to_action(46)
4:47.548 aoe q arcane_explosion Fluffy_Pillow 55336.7/67366: 82% mana arcane_charge, rune_of_power, brons_call_to_action(47)
4:48.848 aoe q arcane_explosion Fluffy_Pillow 52088.2/67366: 77% mana arcane_charge(2), brons_call_to_action(48)
4:50.148 aoe q arcane_explosion Fluffy_Pillow 48839.7/67366: 72% mana arcane_charge(3), clearcasting, brons_call_to_action(49)
4:51.446 aoe r arcane_barrage Fluffy_Pillow 50588.5/67366: 75% mana arcane_charge(4), brons_call_to_action(50)
4:52.747 aoe q arcane_explosion Fluffy_Pillow 55036.0/67366: 82% mana brons_call_to_action(51)
4:54.047 aoe q arcane_explosion Fluffy_Pillow 51787.5/67366: 77% mana arcane_charge, brons_call_to_action(52)
4:55.346 aoe q arcane_explosion Fluffy_Pillow 48537.7/67366: 72% mana arcane_charge(2), brons_call_to_action(53)
4:56.644 aoe q arcane_explosion Fluffy_Pillow 45286.5/67366: 67% mana arcane_charge(3), clearcasting, brons_call_to_action(54)
4:57.942 aoe r arcane_barrage Fluffy_Pillow 47035.3/67366: 70% mana arcane_charge(4), brons_call_to_action(55)
4:59.243 aoe q arcane_explosion Fluffy_Pillow 51482.8/67366: 76% mana brons_call_to_action(56)
5:00.545 aoe q arcane_explosion Fluffy_Pillow 48237.0/67366: 72% mana arcane_charge, brons_call_to_action(57)
5:01.844 shared_cds w time_warp Fluffy_Pillow 44987.1/67366: 67% mana arcane_charge(2), clearcasting, brons_call_to_action(58)
5:01.844 aoe q arcane_explosion Fluffy_Pillow 42987.1/67366: 64% mana arcane_charge(2), clearcasting, temporal_warp, brons_call_to_action(59)
5:02.844 aoe q arcane_explosion Fluffy_Pillow 44334.5/67366: 66% mana arcane_charge(3), temporal_warp, brons_call_to_action(59)
5:03.847 aoe r arcane_barrage Fluffy_Pillow 40685.8/67366: 60% mana arcane_charge(4), clearcasting, temporal_warp, brons_call_to_action(60)
5:04.846 aoe p arcane_orb Fluffy_Pillow 44726.4/67366: 66% mana clearcasting, temporal_warp, brons_call_to_action(61)
5:05.847 aoe r arcane_barrage Fluffy_Pillow 45575.1/67366: 68% mana arcane_charge(4), clearcasting, temporal_warp, crimson_chorus, brons_call_to_action(62)
5:06.847 aoe q arcane_explosion Fluffy_Pillow 49617.0/67366: 74% mana clearcasting, temporal_warp, crimson_chorus, brons_call_to_action(63)
5:07.847 aoe q arcane_explosion Fluffy_Pillow 50964.3/67366: 76% mana arcane_charge, temporal_warp, crimson_chorus, brons_call_to_action(64)
5:08.849 aoe q arcane_explosion Fluffy_Pillow 47314.3/67366: 70% mana arcane_charge(2), temporal_warp, crimson_chorus, brons_call_to_action(65)
5:09.850 aoe q arcane_explosion Fluffy_Pillow 43663.0/67366: 65% mana arcane_charge(3), temporal_warp, crimson_chorus, brons_call_to_action(66)
5:10.851 aoe r arcane_barrage Fluffy_Pillow 40011.7/67366: 59% mana arcane_charge(4), temporal_warp, crimson_chorus, brons_call_to_action(67)
5:11.851 aoe q arcane_explosion Fluffy_Pillow 44053.6/67366: 65% mana temporal_warp, crimson_chorus, brons_call_to_action(68)
5:12.852 aoe q arcane_explosion Fluffy_Pillow 40402.3/67366: 60% mana arcane_charge, temporal_warp, crimson_chorus, brons_call_to_action(69)
5:13.854 aoe q arcane_explosion Fluffy_Pillow 36752.3/67366: 55% mana arcane_charge(2), temporal_warp, crimson_chorus, brons_call_to_action(70)
5:14.857 aoe q arcane_explosion Fluffy_Pillow 33103.6/67366: 49% mana arcane_charge(3), clearcasting, temporal_warp, crimson_chorus(2), brons_call_to_action(71)
5:15.857 aoe r arcane_barrage Fluffy_Pillow 34450.9/67366: 51% mana arcane_charge(4), temporal_warp, crimson_chorus(2), brons_call_to_action(72)
5:16.858 aoe q arcane_explosion Fluffy_Pillow 38494.2/67366: 57% mana temporal_warp, crimson_chorus(2), brons_call_to_action(73)
5:17.858 aoe q arcane_explosion Fluffy_Pillow 34841.6/67366: 52% mana arcane_charge, temporal_warp, crimson_chorus(2), brons_call_to_action(74)
5:18.860 aoe q arcane_explosion Fluffy_Pillow 31191.6/67366: 46% mana arcane_charge(2), temporal_warp, crimson_chorus(2), brons_call_to_action(75)
5:19.862 aoe q arcane_explosion Fluffy_Pillow 27541.6/67366: 41% mana arcane_charge(3), temporal_warp, crimson_chorus(2), brons_call_to_action(76)
5:20.863 aoe r arcane_barrage Fluffy_Pillow 23890.2/67366: 35% mana arcane_charge(4), temporal_warp, crimson_chorus(2), brons_call_to_action(77)
5:21.863 aoe k radiant_spark Fluffy_Pillow 27932.2/67366: 41% mana temporal_warp, crimson_chorus(2), brons_call_to_action(78)
5:22.862 aoe m touch_of_the_magi Fluffy_Pillow 28278.1/67366: 42% mana temporal_warp, crimson_chorus(2), brons_call_to_action(79)
5:23.862 aoe o rune_of_power Fluffy_Pillow 27125.5/67366: 40% mana arcane_charge(4), temporal_warp, crimson_chorus(2), brons_call_to_action(80)
5:24.863 aoe r arcane_barrage Fluffy_Pillow 28474.1/67366: 42% mana arcane_charge(4), rune_of_power, temporal_warp, crimson_chorus(3), brons_call_to_action(81)
5:25.864 aoe p arcane_orb Fluffy_Pillow 32517.4/67366: 48% mana rune_of_power, temporal_warp, crimson_chorus(3), brons_call_to_action(81)
5:26.865 aoe r arcane_barrage Fluffy_Pillow 33366.1/67366: 50% mana arcane_charge(4), rune_of_power, temporal_warp, crimson_chorus(3), brons_call_to_action(82)
5:27.866 aoe q arcane_explosion Fluffy_Pillow 37409.4/67366: 56% mana rune_of_power, temporal_warp, crimson_chorus(3), brons_call_to_action(83)
5:28.865 aoe q arcane_explosion Fluffy_Pillow 33755.3/67366: 50% mana arcane_charge, rune_of_power, temporal_warp, crimson_chorus(3), brons_call_to_action(84)
5:29.866 aoe q arcane_explosion Fluffy_Pillow 30104.0/67366: 45% mana arcane_charge(2), clearcasting, rune_of_power, temporal_warp, crimson_chorus(3), brons_call_to_action(85)
5:30.866 aoe q arcane_explosion Fluffy_Pillow 31451.3/67366: 47% mana arcane_charge(3), rune_of_power, temporal_warp, crimson_chorus(3), brons_call_to_action(86)
5:31.864 aoe r arcane_barrage Fluffy_Pillow 27795.9/67366: 41% mana arcane_charge(4), clearcasting, rune_of_power, temporal_warp, crimson_chorus(3), brons_call_to_action(87)
5:32.864 aoe q arcane_explosion Fluffy_Pillow 31837.9/67366: 47% mana clearcasting, rune_of_power, temporal_warp, crimson_chorus(3), brons_call_to_action(88)
5:33.865 aoe q arcane_explosion Fluffy_Pillow 33186.5/67366: 49% mana arcane_charge, rune_of_power, temporal_warp, crimson_chorus(3), brons_call_to_action(89)
5:34.867 aoe q arcane_explosion Fluffy_Pillow 29536.5/67366: 44% mana arcane_charge(2), rune_of_power, temporal_warp
5:35.868 aoe q arcane_explosion Fluffy_Pillow 25885.2/67366: 38% mana arcane_charge(3), rune_of_power, temporal_warp, brons_call_to_action
5:36.869 aoe r arcane_barrage Fluffy_Pillow 22233.9/67366: 33% mana arcane_charge(4), clearcasting, temporal_warp, brons_call_to_action(2)
5:37.871 aoe q arcane_explosion Fluffy_Pillow 26278.5/67366: 39% mana clearcasting, temporal_warp, brons_call_to_action(3)
5:38.871 aoe q arcane_explosion Fluffy_Pillow 27625.8/67366: 41% mana arcane_charge, temporal_warp, brons_call_to_action(4)
5:39.871 aoe q arcane_explosion Fluffy_Pillow 23973.1/67366: 36% mana arcane_charge(2), temporal_warp, brons_call_to_action(5)
5:40.870 aoe q arcane_explosion Fluffy_Pillow 20319.1/67366: 30% mana arcane_charge(3), temporal_warp, brons_call_to_action(6)
5:41.870 aoe r arcane_barrage Fluffy_Pillow 16666.4/67366: 25% mana arcane_charge(4), brons_call_to_action(7)
5:43.170 aoe q arcane_explosion Fluffy_Pillow 21112.5/67366: 31% mana brons_call_to_action(8)
5:44.472 aoe q arcane_explosion Fluffy_Pillow 17866.7/67366: 27% mana arcane_charge, brons_call_to_action(9)
5:45.771 aoe q arcane_explosion Fluffy_Pillow 14616.9/67366: 22% mana arcane_charge(2), brons_call_to_action(10)
5:47.073 aoe q arcane_explosion Fluffy_Pillow 11371.1/67366: 17% mana arcane_charge(3), brons_call_to_action(11)
5:48.372 aoe r arcane_barrage Fluffy_Pillow 8121.3/67366: 12% mana arcane_charge(4), brons_call_to_action(12)
5:49.672 aoe p arcane_orb Fluffy_Pillow 12567.4/67366: 19% mana brons_call_to_action(13)

Stats

Level Bonus (60) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 198 1 199 199 0
Agility 306 2 308 308 0
Stamina 414 0 2013 1918 1504
Intellect 450 -3 1767 1588 1066 (46)
Spirit 0 0 0 0 0
Health 40260 38360 0
Mana 67366 67366 0
Spell Power 1767 1588 0
Crit 15.74% 15.74% 376
Haste 15.76% 15.76% 520
Versatility 7.97% 7.97% 319
Mana Regen 1347 1347 0
Mastery 34.73% 34.73% 733
Armor 369 369 369
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 227.00
Local Head Confidant's Favored Cap
ilevel: 226, stats: { 44 Armor, +82 Int, +149 Sta, +44 Haste, +98 Mastery }
Local Neck Noble's Birthstone Pendant
ilevel: 226, stats: { +84 Sta, +52 Crit, +162 Mastery }
Local Shoulders Shawl of the Penitent
ilevel: 233, stats: { 42 Armor, +65 Int, +122 Sta, +33 Crit, +76 Haste }
Local Chest Robes of the Cursed Commando
ilevel: 233, stats: { 61 Armor, +87 Int, +162 Sta, +47 Crit, +100 Haste }, enchant: { +20 Int }
Local Waist Cinch of Infinite Tightness
ilevel: 226, stats: { 33 Armor, +61 Int, +112 Sta, +69 Crit, +36 Vers }
Local Legs Courtier's Costume Trousers
ilevel: 226, stats: { 51 Armor, +82 Int, +149 Sta, +49 Vers, +93 Mastery }
Local Feet Slippers of the Forgotten Heretic
ilevel: 226, stats: { 36 Armor, +61 Int, +112 Sta, +73 Crit, +32 Mastery }
Local Wrists Acolyte's Velvet Bindings
ilevel: 226, stats: { 29 Armor, +46 Int, +84 Sta, +26 Vers, +53 Mastery }, enchant: { +15 Int }
Local Hands Impossibly Oversized Mitts
ilevel: 226, stats: { 33 Armor, +61 Int, +112 Sta, +31 Haste, +74 Mastery }
Local Finger1 Most Regal Signet of Sire Denathrius
ilevel: 233, stats: { +91 Sta, +178 Haste, +48 Mastery }, enchant: { +16 Mastery }
item effects: { equip: Denathrius' Privilege }
Local Finger2 Shadowghast Ring
ilevel: 235, stats: { +94 Sta, +115 Mastery, +115 Vers }, enchant: { +16 Mastery }
item effects: { equip: Temporal Warp }
Local Trinket1 Cabalist's Hymnal
ilevel: 226, stats: { +77 Int }
item effects: { equip: Crimson Chorus }
Local Trinket2 Sinful Aspirant's Badge of Ferocity
ilevel: 207, stats: { +91 Haste }
item effects: { use: Gladiator's Badge }
Local Back Mantle of Manifest Sins
ilevel: 226, stats: { 40 Armor, +84 Sta, +53 Crit, +26 Mastery, +46 StrAgiInt }
Local Main Hand Staff of the Penitent
ilevel: 226, weapon: { 93 - 128, 3.6 }, stats: { +82 Int, +281 Int, +149 Sta, +49 Crit, +93 Vers }, enchant: sinful_revelation

Profile

mage="Kyrian_Forgelite"
source=default
spec=arcane
level=60
race=troll
role=spell
position=back
talents=1031021
talent_override=resonance,if=3>2
covenant=kyrian
soulbind=333950//51:6

# Default consumables
potion=deathly_fixation
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=variable,name=prepull_evo,op=reset,default=0
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
actions.precombat+=/variable,name=have_opened,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
actions.precombat+=/variable,name=final_burn,op=set,value=0
actions.precombat+=/variable,name=rs_max_delay,op=reset,default=5
actions.precombat+=/variable,name=ap_max_delay,op=reset,default=10
actions.precombat+=/variable,name=rop_max_delay,op=reset,default=20
actions.precombat+=/variable,name=totm_max_delay,op=reset,default=5
actions.precombat+=/variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
actions.precombat+=/variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
actions.precombat+=/variable,name=barrage_mana_pct,op=reset,default=70
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=reset,default=30
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
actions.precombat+=/variable,name=totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=aoe_totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=am_spam,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
actions.precombat+=/variable,name=am_spam_evo_pct,op=reset,default=15
actions.precombat+=/flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_familiar
actions.precombat+=/arcane_intellect
actions.precombat+=/conjure_mana_gem
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/frostbolt,if=variable.prepull_evo<=0
actions.precombat+=/evocation,if=variable.prepull_evo>0

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/call_action_list,name=shared_cds
actions+=/call_action_list,name=essences
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/call_action_list,name=opener,if=variable.have_opened<=0
actions+=/call_action_list,name=am_spam,if=variable.am_spam=1
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=rotation,if=variable.final_burn=0
actions+=/call_action_list,name=final_burn,if=variable.final_burn=1
actions+=/call_action_list,name=movement

actions.am_spam=cancel_action,if=action.evocation.channeling&mana.pct>=95
actions.am_spam+=/evocation,if=mana.pct<=variable.am_spam_evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/rune_of_power,if=buff.rune_of_power.down&cooldown.arcane_power.remains>0
actions.am_spam+=/touch_of_the_magi,if=(cooldown.arcane_power.remains=0&buff.rune_of_power.down)|prev_gcd.1.rune_of_power
actions.am_spam+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&buff.rune_of_power.down&essence.vision_of_perfection.enabled
actions.am_spam+=/arcane_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.ap_max_delay
actions.am_spam+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=action.arcane_missiles.execute_time&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_barrage,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_missiles,if=buff.clearcasting.react,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/arcane_missiles,if=!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.am_spam+=/arcane_barrage
actions.am_spam+=/arcane_blast

actions.aoe=frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
actions.aoe+=/arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
actions.aoe+=/mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
actions.aoe+=/arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
actions.aoe+=/rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
actions.aoe+=/presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
actions.aoe+=/arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
actions.aoe+=/supernova
actions.aoe+=/arcane_orb,if=buff.arcane_charge.stack=0
actions.aoe+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
actions.aoe+=/arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1

# Prioritize using grisly icicle with ap. Use it with totm otherwise.
actions.cooldowns=frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.cooldowns+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
# Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
# Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
actions.cooldowns+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
# Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
# Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
# Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
actions.cooldowns+=/arcane_power,if=(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
actions.cooldowns+=/rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
# Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
actions.cooldowns+=/presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
# Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.cooldowns+=/presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled

actions.essences=blood_of_the_enemy,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/blood_of_the_enemy,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains>=50&cooldown.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay
actions.essences+=/worldvein_resonance,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/guardian_of_azeroth,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/guardian_of_azeroth,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/concentrated_flame,line_cd=6,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/reaping_flames,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/focused_azerite_beam,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/purifying_blast,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/ripple_in_space,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/the_unbound_force,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/memory_of_lucid_dreams,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down

actions.final_burn=arcane_missiles,if=buff.clearcasting.react,chain=1
actions.final_burn+=/arcane_blast
actions.final_burn+=/arcane_barrage

actions.movement=blink_any,if=movement.distance>=10
actions.movement+=/presence_of_mind
actions.movement+=/arcane_missiles,if=movement.distance<10
actions.movement+=/arcane_orb
actions.movement+=/fire_blast

actions.opener=variable,name=have_opened,op=set,value=1,if=prev_gcd.1.evocation
actions.opener+=/fire_blast,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command_frost.up
actions.opener+=/frost_nova,if=runeforge.grisly_icicle.equipped&mana.pct>95
actions.opener+=/mirrors_of_torment
actions.opener+=/deathborne
actions.opener+=/radiant_spark,if=mana.pct>40
actions.opener+=/cancel_action,if=action.shifting_power.channeling&gcd.remains=0
actions.opener+=/shifting_power,if=soulbind.field_of_blossoms.enabled
actions.opener+=/touch_of_the_magi
actions.opener+=/arcane_power
actions.opener+=/rune_of_power,if=buff.rune_of_power.down
actions.opener+=/presence_of_mind
actions.opener+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.opener+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.opener+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.opener+=/arcane_missiles,if=buff.clearcasting.react,chain=1
actions.opener+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges&(cooldown.arcane_power.remains>10|active_enemies<=2)
actions.opener+=/arcane_blast,if=buff.rune_of_power.up|mana.pct>15
actions.opener+=/evocation,if=buff.rune_of_power.down,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.opener+=/arcane_barrage

actions.rotation=variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
actions.rotation+=/strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
actions.rotation+=/arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
actions.rotation+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.rotation+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.rotation+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
actions.rotation+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
actions.rotation+=/supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.rotation+=/arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
actions.rotation+=/arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_blast
actions.rotation+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.rotation+=/arcane_barrage

actions.shared_cds=use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
actions.shared_cds+=/use_items,if=buff.arcane_power.up
actions.shared_cds+=/potion,if=buff.arcane_power.up
actions.shared_cds+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
actions.shared_cds+=/lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/berserking,if=buff.arcane_power.up
actions.shared_cds+=/blood_fury,if=buff.arcane_power.up
actions.shared_cds+=/fireblood,if=buff.arcane_power.up
actions.shared_cds+=/ancestral_call,if=buff.arcane_power.up

head=confidants_favored_cap,id=183021,bonus_id=1498,ilevel=226
neck=nobles_birthstone_pendant,id=183039,bonus_id=1498,ilevel=226
shoulders=shawl_of_the_penitent,id=183020,bonus_id=1498,ilevel=233
back=mantle_of_manifest_sins,id=183033,bonus_id=1498,ilevel=226
chest=robes_of_the_cursed_commando,id=182998,bonus_id=1498,ilevel=233,enchant=eternal_insight
wrists=acolytes_velvet_bindings,id=183017,bonus_id=1498,ilevel=226,enchant=eternal_intellect
hands=impossibly_oversized_mitts,id=183022,bonus_id=1498,ilevel=226
waist=cinch_of_infinite_tightness,id=183028,bonus_id=1498,ilevel=226
legs=courtiers_costume_trousers,id=183011,bonus_id=1498,ilevel=226
feet=slippers_of_the_forgotten_heretic,id=182979,bonus_id=1498,ilevel=226
finger1=most_regal_signet_of_sire_denathrius,id=183036,bonus_id=1498,ilevel=233,enchant=16mastery
finger2=shadowghast_ring,id=178926,bonus_id=6648/6650/6758/6834/1532,ilevel=235,enchant=16mastery
trinket1=cabalists_hymnal,id=184028,bonus_id=1498,ilevel=226
trinket2=sinful_aspirants_badge_of_ferocity,id=175884,bonus_id=1521,ilevel=207
main_hand=staff_of_the_penitent,id=180000,bonus_id=7187/6652/1524,ilevel=226,enchant=sinful_revelation

# Gear Summary
# gear_ilvl=226.73
# gear_stamina=1504
# gear_intellect=1066
# gear_crit_rating=376
# gear_haste_rating=520
# gear_mastery_rating=733
# gear_versatility_rating=319
# gear_armor=369

Kyrian_Pelagos : 8644 dps, 3823 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
8644.3 8644.3 11.8 / 0.137% 860.4 / 10.0% 4.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
2157.7 2057.5 Mana 0.00% 53.3 100.0% 100%
Talents
Kyrian
Runeforge

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Kyrian_Pelagos 8644
Arcane Barrage 3240 37.5% 58.5 5.13sec 16613 14085 Direct 175.2 4643 9450 5545 18.8%

Stats Details: Arcane Barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 58.47 175.19 0.00 0.00 1.1795 0.0000 971341.30 971341.30 0.00% 14084.55 14084.55
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.22% 142.29 103 187 4643.04 1500 18274 4645.77 4204 5049 660536 660536 0.00%
crit 18.78% 32.89 13 58 9449.90 4309 36548 9448.10 6238 13447 310805 310805 0.00%

Action Details: Arcane Barrage

  • id:44425
  • school:arcane
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.728000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=0 + 72.8%} Arcane damage. For each Arcane Charge, deals {$36032s2=30}% additional damage$?a321526[, grants you {$321526s1=2}% of your maximum mana,][]$?a231564[ and hits {$36032s3=0} additional nearby $Ltarget:targets; for {$s2=40}% of its damage][]. |cFFFFFFFFConsumes all Arcane Charges.|r

Action Priority List

    aoe
    [r]:58.46
  • if_expr:buff.arcane_charge.stack=buff.arcane_charge.max_stack
    rotation
    [t]:0.00
Arcane Explosion 3755 43.5% 160.0 1.85sec 7038 6062 Direct 480.1 1963 4007 2346 18.7%

Stats Details: Arcane Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 160.04 480.11 0.00 0.00 1.1609 0.0000 1126272.08 1126272.08 0.00% 6062.46 6062.46
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.26% 390.13 299 501 1963.26 1427 5812 1964.07 1867 2110 765763 765763 0.00%
crit 18.74% 89.97 55 136 4007.03 2855 11623 4009.36 3462 4625 360509 360509 0.00%

Action Details: Arcane Explosion

  • id:1449
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.502320
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s2=0 + 50.2%} Arcane damage to all enemies within $A2 yards.$?a137021[ |cFFFFFFFFGenerates {$s1=1} Arcane Charge if any targets are hit.|r][]

Action Priority List

    aoe
    [q]:160.02
  • if_expr:buff.arcane_charge.stack<buff.arcane_charge.max_stack
Arcane Orb 0 (678) 0.0% (7.8%) 13.2 23.46sec 15433 12912

Stats Details: Arcane Orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.18 0.00 0.00 0.00 1.1953 0.0000 0.00 0.00 0.00% 12912.10 12912.10

Action Details: Arcane Orb

  • id:153626
  • school:arcane
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:153626
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r

Action Priority List

    aoe
    [p]:13.18
  • if_expr:buff.arcane_charge.stack=0
    Arcane Orb (_bolt) 678 7.8% 39.5 23.46sec 5152 0 Direct 39.5 4314 8859 5153 18.5%

Stats Details: Arcane Orb Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.47 39.47 0.00 0.00 0.0000 0.0000 203378.42 203378.42 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.54% 32.19 22 44 4314.09 2821 9024 4313.36 3481 4941 138812 138812 0.00%
crit 18.46% 7.29 0 17 8859.23 5642 18049 8851.63 0 15479 64567 64567 0.00%

Action Details: Arcane Orb Bolt

  • id:153640
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.092000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:153640
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:{$@spelldesc153626=Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r}
Deathly Fixation 0 (87) 0.0% (1.0%) 18.7 1.34sec 1369 0

Stats Details: Deathly Fixation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.71 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Deathly Fixation

  • id:322253
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:42.90
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322253
  • name:Deathly Fixation
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1.
  • description:Deal {$s1=43} Shadow damage every $t1. Stacks up to 5 times.
    Deathly Eruption 87 1.0% 18.7 1.34sec 1369 0 Direct 18.7 1137 2274 1368 20.5%

Stats Details: Deathly Eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.71 18.71 0.00 0.00 0.0000 0.0000 25620.78 25620.78 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.54% 14.88 5 25 1136.64 1117 1184 1136.60 1117 1184 16915 16915 0.00%
crit 20.46% 3.83 0 12 2274.32 2233 2367 2237.80 0 2367 8706 8706 0.00%

Action Details: Deathly Eruption

  • id:322256
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:984.99
  • base_dd_max:984.99
  • base_dd_mult:1.00

Spelldata

  • id:322256
  • name:Deathly Eruption
  • school:shadow
  • tooltip:
  • description:Deal {$s1=985} Shadow damage.
Eternal Insight 39 0.5% 21.2 14.04sec 551 0 Direct 21.2 464 927 551 18.7%

Stats Details: Eternal Insight

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 21.24 21.24 0.00 0.00 0.0000 0.0000 11693.29 11693.29 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.28% 17.26 7 31 463.75 453 481 463.74 453 475 8007 8007 0.00%
crit 18.72% 3.98 0 12 927.13 907 961 909.95 0 961 3687 3687 0.00%

Action Details: Eternal Insight

  • id:342314
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:400.00
  • base_dd_max:400.00
  • base_dd_mult:1.00

Spelldata

  • id:342314
  • name:Eternal Insight
  • school:shadow
  • tooltip:
  • description:Deals {$s1=400} Shadow damage.
Frostbolt 4 0.0% 0.0 0.00sec 0 0 Direct 1.0 1024 2047 1189 16.1%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 1.00 0.00 0.00 0.0000 0.0000 1189.01 1189.01 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.85% 0.84 0 1 1023.69 1024 1024 858.38 0 1024 858 858 0.00%
crit 16.15% 0.16 0 1 2047.39 2047 2047 330.62 0 2047 331 331 0.00%

Action Details: Frostbolt

  • id:116
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.511000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116
  • name:Frostbolt
  • school:frost
  • tooltip:
  • description:Launches a bolt of frost at the enemy, causing {$228597s1=0} Frost damage and slowing movement speed by {$205708s1=50}% for {$205708d=8 seconds}.
Mirror Image 0 (19) 0.0% (0.2%) 1.0 0.00sec 5745 0

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.
    Frostbolt (mirror_image) 144  / 19 0.2% 117.0 0.99sec 49 49 Direct 117.0 41 83 49 19.7%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 117.00 117.00 0.00 0.00 1.0091 0.0000 5744.72 5744.72 0.00% 48.66 48.66
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.27% 93.92 80 107 40.88 30 51 40.88 39 42 3839 3839 0.00%
crit 19.73% 23.08 10 37 82.54 59 101 82.52 67 92 1905 1905 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:40.00
Radiant Spark 144 1.7% 9.0 34.54sec 4756 3886 Direct 9.0 2437 5025 2923 18.8%
Periodic 62.9 222 447 264 18.4% 9.9%

Stats Details: Radiant Spark

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.05 9.05 62.85 62.85 1.2239 1.4134 43039.53 43039.53 0.00% 430.78 3886.19
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.18% 7.35 3 11 2436.90 1963 5302 2429.37 1963 3050 17893 17893 0.00%
crit 18.82% 1.70 0 6 5025.49 3926 10005 4201.81 0 10005 8560 8560 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 81.56% 51.26 36 69 222.45 54 446 222.46 200 269 11404 11404 0.00%
crit 18.44% 11.59 3 26 447.15 108 892 447.22 310 674 5183 5183 0.00%

Action Details: Radiant Spark

  • id:307443
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.760000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.082400
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:10.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:307443
  • name:Radiant Spark
  • school:arcane
  • tooltip:Suffering $w2 Arcane damage every $t2 sec.
  • description:Conjure a radiant spark that causes {$s1=0 + 76.0%} Arcane damage instantly, and an additional $o2 damage over {$d=10 seconds}. The target takes {$307454s1=10}% increased damage from your direct damage spells, stacking each time they are struck. This effect ends after {$307454u=4} spells.

Action Priority List

    aoe
    [j]:5.70
  • if_expr:cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
    aoe
    [k]:3.32
  • if_expr:cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
    aoe
    [l]:0.07
  • if_expr:cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
Touch of the Magi 0 (679) 0.0% (7.8%) 6.1 52.39sec 33256 27729

Stats Details: Touch Of The Magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.12 0.00 0.00 0.00 1.1994 0.0000 0.00 0.00 0.00% 27729.49 27729.49

Action Details: Touch Of The Magi

  • id:321507
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:4.0

Spelldata

  • id:321507
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]

Action Priority List

    aoe
    [m]:6.14
  • if_expr:buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
    Touch of the Magi (_explosion) 679 7.8% 6.1 52.29sec 33256 0 Direct 18.3 11100 0 11100 0.0%

Stats Details: Touch Of The Magi Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.12 18.32 0.00 0.00 0.0000 0.0000 203395.81 203395.81 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 18.32 15 21 11099.53 32 49200 11095.71 8356 14825 203396 203396 0.00%

Action Details: Touch Of The Magi Explosion

  • id:210833
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:5357.94
  • base_dd_max:5357.94
  • base_dd_mult:1.00

Spelldata

  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc321507=Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]}
Simple Action Stats Execute Interval
Kyrian_Pelagos
Arcane Power 2.8 128.90sec

Stats Details: Arcane Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.84 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Power

  • id:12042
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].

Action Priority List

    aoe
    [n]:2.84
  • if_expr:((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
Berserking 1.8 258.31sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.84 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    shared_cds
    [y]:1.84
  • if_expr:buff.arcane_power.up
Conjure Mana Gem 1.0 0.00sec

Stats Details: Conjure Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Conjure Mana Gem

  • id:759
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:9000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:759
  • name:Conjure Mana Gem
  • school:arcane
  • tooltip:
  • description:Conjures a Mana Gem that can be used to instantly restore {$5405s1=10}% mana, and holds up to {$s2=3} charges. $@spellname118812 {$@spelldesc118812=Conjured items disappear if logged out for more than 15 minutes.}
Evocation 0.9 197.03sec

Stats Details: Evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.93 0.00 5.53 0.00 4.1762 0.7026 0.00 0.00 0.00% 0.00 0.00

Action Details: Evocation

  • id:12051
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Kyrian_Pelagos
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.

Action Priority List

    aoe
    [s]:0.93
  • interrupt_if_expr:mana.pct>=85
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Kyrian_Pelagos
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Kyrian_Pelagos
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Deathly Fixation (potion) 1.0 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307497
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    shared_cds
    [w]:1.00
  • if_expr:buff.arcane_power.up
Rune of Power 6.0 51.31sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.96 0.00 0.00 0.00 1.1972 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    aoe
    [o]:5.98
  • if_expr:buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Time Warp 1.5 300.56sec

Stats Details: Time Warp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.49 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Time Warp

  • id:80353
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:2000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:80353
  • name:Time Warp
  • school:arcane
  • tooltip:Haste increased by $w1%. $?$W4>0[Time rate increased by $w4%.][]$?$W3=1[ When the effect ends, you die.][]
  • description:Warp the flow of time, increasing haste by {$s1=30}% $?a320919[and time rate by {$s4=0}% ][]for all party and raid members for {$d=40 seconds}. Allies will be unable to benefit from Bloodlust, Heroism, or Time Warp again for {$57724d=600 seconds}.$?a320920[ When the effect ends, you die.][]

Action Priority List

    shared_cds
    [x]:1.48
  • if_expr:runeforge.temporal_warp.equipped&buff.exhaustion.up
Replenish Mana (use_mana_gem) 2.7 124.75sec

Stats Details: Use Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.74 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Use Mana Gem

  • id:5405
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Kyrian_Pelagos
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5405
  • name:Replenish Mana
  • school:physical
  • tooltip:Restoring $w2 mana every $t1 sec.
  • description:Restores {$s1=10}% mana.

Action Priority List

    shared_cds
    [u]:2.75
  • if_expr:(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Arcane Charge 59.2 159.6 5.1sec 1.4sec 3.7sec 72.79% 0.00% 1.2 (1.4) 0.0

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.8s / 13.4s
  • trigger_min/max:0.0s / 8.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.9s

Stack Uptimes

  • arcane_charge_1:19.83%
  • arcane_charge_2:16.30%
  • arcane_charge_3:15.97%
  • arcane_charge_4:20.68%

Spelldata

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 2.8 0.0 128.9sec 128.9sec 14.7sec 13.88% 0.00% 0.0 (0.0) 2.7

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:121.4s / 137.1s
  • trigger_min/max:121.4s / 137.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • arcane_power_1:13.88%

Spelldata

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Berserking 1.8 0.0 258.3sec 258.3sec 11.7sec 7.11% 12.59% 0.0 (0.0) 1.7

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:247.7s / 263.6s
  • trigger_min/max:247.7s / 263.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • berserking_1:7.11%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.51% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.51%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Clearcasting 25.5 0.2 11.4sec 11.4sec 1.9sec 16.30% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_clearcasting
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • clearcasting_1:16.11%
  • clearcasting_2:0.20%
  • clearcasting_3:0.02%

Spelldata

  • id:263725
  • name:Clearcasting
  • tooltip:Your next Arcane Missiles or Arcane Explosion costs no mana{$?s321758=false}[ and Arcane Missiles fires an additional missile][].
  • description:{$@spelldesc79684=For each ${$c*100/{$s1=200}} mana you spend, you have a 1% chance to gain Clearcasting, making your next Arcane Missiles or Arcane Explosion free and channel {$277726s1=20}% faster.$?a321758[ Arcane Missiles fires {$321758s2=1} additional missile.][]}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Combat Meditation 4.8 0.0 68.4sec 68.4sec 7.9sec 12.60% 0.00% 9.4 (9.4) 4.7

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_combat_meditation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:0.50
  • base cooldown:60.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:extend
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:3.00

Stat Details

  • stat:mastery_rating
  • amount:350.00

Trigger Details

  • interval_min/max:62.5s / 87.0s
  • trigger_min/max:62.5s / 87.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • combat_meditation_1:12.60%

Spelldata

  • id:328908
  • name:Combat Meditation
  • tooltip:Mastery increased by $w.
  • description:{$@spelldesc328266=$?a137005[Shackle the Unworthy]?a212611[Elysian Decree]?a137009[Kindred Spirits]?a137014[Resonating Arrow]?a137018[Radiant Spark]?a137022[Weapons of Order]?a137026[Divine Toll]?a137030[Boon of the Ascended]?a137034[Echoing Reprimand]?a137038[Vesper Totem]?a137042[Scouring Tithe]?a137047[Spear of Bastion][Activating your Kyrian class ability] increases your Mastery by $328908m1 for ${{$328908d=10 seconds}*$<mod>}.1 sec and occasionally expels Sorrowful Memories. Walking through Sorrowful Memories extends this effect by ${$328913m2*$<mod>}.1 sec. $?a137018|?a137034[Combat Meditation may only occur once every {$345861d=60 seconds}.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Crimson Chorus 5.4 0.0 61.1sec 61.1sec 28.6sec 51.62% 0.00% 0.0 (0.0) 4.9

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_crimson_chorus
  • max_stacks:3
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:60.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:10.00
  • associated item:Cabalist's Hymnal

Stat Details

  • stat:crit_rating
  • amount:95.00

Trigger Details

  • interval_min/max:60.0s / 65.5s
  • trigger_min/max:60.0s / 65.5s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 30.0s

Stack Uptimes

  • crimson_chorus_1:17.80%
  • crimson_chorus_2:17.19%
  • crimson_chorus_3:16.63%

Spelldata

  • id:344803
  • name:Crimson Chorus
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc344806=Join the Crimson Chorus. Every minute, your Critical Strike swells by ${{$s1=44}*3} over ${{$344803d=10 seconds}*3} sec. before returning to normal. This effect is increased by {$s2=5}% for each member of the Crimson Chorus in your party.}
  • max_stacks:3
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Evocation 0.9 0.0 217.0sec 217.0sec 4.2sec 1.29% 0.00% 3.7 (3.7) 0.0

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_evocation
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:7.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:1.00

Trigger Details

  • interval_min/max:92.4s / 291.8s
  • trigger_min/max:92.4s / 291.8s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 4.3s

Stack Uptimes

  • evocation_1:1.29%

Spelldata

  • id:12051
  • name:Evocation
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Gladiator's Badge 2.8 0.0 128.9sec 128.9sec 14.7sec 13.88% 0.00% 0.0 (0.0) 2.7

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_gladiators_badge
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Sinful Aspirant's Badge of Ferocity

Stat Details

  • stat:intellect
  • amount:342.00

Trigger Details

  • interval_min/max:121.4s / 137.1s
  • trigger_min/max:121.4s / 137.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • gladiators_badge_1:13.88%

Spelldata

  • id:345228
  • name:Gladiator's Badge
  • tooltip:Primary stat increased by $w1.
  • description:Increases primary stat by {$s1=252} for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:0.00%
Potion of Deathly Fixation 1.0 0.0 0.0sec 0.0sec 25.0sec 8.45% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_potion_of_deathly_fixation
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:25.0s / 25.0s

Stack Uptimes

  • potion_of_deathly_fixation_1:8.45%

Spelldata

  • id:307497
  • name:Potion of Deathly Fixation
  • tooltip:Chance to apply Deathly Fixation to your target.
  • description:Your damaging spells and abilities have a chance to apply Deathly Fixation to your target, dealing {$322253s1=43} Shadow damage over {$322253d=8 seconds} and stacking up to 5 times. Upon reaching 5 stacks, Deathly Fixation explodes, dealing {$322256s1=985} Shadow damage to the target. If you consume this potion while your weapon is augmented with Shadowcore Oil, the explosion damage is increased by {$s2=10}%. Lasts {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Rune of Power 8.8 0.0 35.3sec 35.3sec 11.8sec 34.63% 0.00% 0.0 (0.0) 8.5

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.6s / 55.0s
  • trigger_min/max:13.6s / 55.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • rune_of_power_1:34.63%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Temporal Warp 1.5 0.0 300.6sec 300.6sec 35.3sec 17.21% 0.00% 0.0 (0.0) 1.1

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_temporal_warp
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:300.1s / 301.0s
  • trigger_min/max:300.1s / 301.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 40.0s

Stack Uptimes

  • temporal_warp_1:17.21%

Spelldata

  • id:327355
  • name:Temporal Warp
  • tooltip:Haste increased by $w1%.
  • description:{$@spelldesc327351=While you have Temporal Displacement or other similar effects, you may use Time Warp to grant yourself {$327355s1=30}% Haste for {$327355d=40 seconds}.}
  • max_stacks:0
  • duration:40.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism)

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Benefit Avg % Min Max
Arcane Barrage Arcane Charge 2 0.00% 0.00% 1.47%
Arcane Barrage Arcane Charge 4 100.00% 98.53% 100.00%
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 1.93% 0.42% 6.76% 0.9s 0.0s 6.0s
Conserve Phase 100.00% 100.00% 100.00% 299.9s 240.2s 360.0s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.0000.0000.000179.943120.203239.964
Evocation147.9462.435348.205232.120150.323354.675
Rune of Power6.6900.10423.13041.64323.50055.282
Touch of the Magi5.3730.68522.46934.74622.20157.437
Arcane Power6.4991.36517.10818.9966.18525.710
Arcane Barrage2.7750.0039.634163.437128.059198.683
Arcane Orb3.3890.00011.61844.97534.13361.094
Radiant Spark3.0300.00024.63029.3737.93247.326
Time Warp1.0620.1041.3031.5811.2962.285

Burn Phases

Burn phase duration tracks the amount of time spent in each burn phase. This is defined as the time between a start_burn_phase and stop_burn_phase action being executed. Note that "execute" burn phases, i.e., the final burn of a fight, is also included.

Burn Phase Duration
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Mana at burn start is the mana level recorded (in percentage of total mana) when a start_burn_phase command is executed.

Mana at Burn Start
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Kyrian_Pelagos
mana_regen Mana 580.43 397876.44 64.48% 685.48 10079.57 2.47%
Evocation Mana 43.39 47402.66 7.68% 1092.40 0.00 0.00%
Mana Gem Mana 2.74 18693.78 3.03% 6811.19 0.00 0.00%
Arcane Barrage Mana 58.46 153051.27 24.80% 2617.99 6610.45 4.14%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 66365.7 2057.52 2157.72 16687.3 37475.1 136.8 67365.7
Usage Type Count Total Avg RPE APR
Kyrian_Pelagos
arcane_explosion Mana 160.0 613471.9 3833.7 3833.3 1.8
arcane_orb Mana 13.2 5943.4 451.1 451.0 34.2
radiant_spark Mana 9.0 8388.0 926.9 926.9 5.1
time_warp Mana 1.5 2969.3 2000.0 1992.1 0.0
touch_of_the_magi Mana 6.1 15256.6 2495.1 2494.5 13.3

Statistics & Data Analysis

Fight Length
Kyrian_Pelagos Fight Length
Count 1319
Mean 299.94
Minimum 240.20
Maximum 359.96
Spread ( max - min ) 119.76
Range [ ( max - min ) / 2 * 100% ] 19.96%
DPS
Kyrian_Pelagos Damage Per Second
Count 1319
Mean 8644.28
Minimum 8018.04
Maximum 9533.57
Spread ( max - min ) 1515.53
Range [ ( max - min ) / 2 * 100% ] 8.77%
Standard Deviation 218.7743
5th Percentile 8303.86
95th Percentile 9004.96
( 95th Percentile - 5th Percentile ) 701.09
Mean Distribution
Standard Deviation 6.0238
95.00% Confidence Interval ( 8632.48 - 8656.09 )
Normalized 95.00% Confidence Interval ( 99.86% - 100.14% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 25
0.1% Error 2461
0.1 Scale Factor Error with Delta=300 409
0.05 Scale Factor Error with Delta=300 1635
0.01 Scale Factor Error with Delta=300 40858
Priority Target DPS
Kyrian_Pelagos Priority Target Damage Per Second
Count 1319
Mean 3822.65
Minimum 3427.81
Maximum 4395.82
Spread ( max - min ) 968.01
Range [ ( max - min ) / 2 * 100% ] 12.66%
Standard Deviation 135.4537
5th Percentile 3613.67
95th Percentile 4040.98
( 95th Percentile - 5th Percentile ) 427.31
Mean Distribution
Standard Deviation 3.7297
95.00% Confidence Interval ( 3815.34 - 3829.96 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 49
0.1% Error 4824
0.1 Scale Factor Error with Delta=300 157
0.05 Scale Factor Error with Delta=300 627
0.01 Scale Factor Error with Delta=300 15663
DPS(e)
Kyrian_Pelagos Damage Per Second (Effective)
Count 1319
Mean 8644.28
Minimum 8018.04
Maximum 9533.57
Spread ( max - min ) 1515.53
Range [ ( max - min ) / 2 * 100% ] 8.77%
Damage
Kyrian_Pelagos Damage
Count 1319
Mean 2585930.23
Minimum 1988136.91
Maximum 3158556.05
Spread ( max - min ) 1170419.14
Range [ ( max - min ) / 2 * 100% ] 22.63%
DTPS
Kyrian_Pelagos Damage Taken Per Second
Count 1319
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Kyrian_Pelagos Healing Per Second
Count 1319
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Kyrian_Pelagos Healing Per Second (Effective)
Count 1319
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Kyrian_Pelagos Heal
Count 1319
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Kyrian_Pelagos Healing Taken Per Second
Count 1319
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Kyrian_Pelagos Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Kyrian_PelagosTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Kyrian_Pelagos Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 variable,name=prepull_evo,op=reset,default=0
1 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
2 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
3 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
4 0.00 variable,name=have_opened,op=reset,default=0
5 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
6 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
7 0.00 variable,name=final_burn,op=set,value=0
8 0.00 variable,name=rs_max_delay,op=reset,default=5
9 0.00 variable,name=ap_max_delay,op=reset,default=10
A 0.00 variable,name=rop_max_delay,op=reset,default=20
B 0.00 variable,name=totm_max_delay,op=reset,default=5
C 0.00 variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
D 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
E 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
F 0.00 variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
G 0.00 variable,name=barrage_mana_pct,op=reset,default=70
H 0.00 variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
I 0.00 variable,name=ap_minimum_mana_pct,op=reset,default=30
J 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
K 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
L 0.00 variable,name=totm_max_charges,op=reset,default=2
M 0.00 variable,name=aoe_totm_max_charges,op=reset,default=2
N 0.00 variable,name=am_spam,op=reset,default=0
O 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
P 0.00 variable,name=am_spam_evo_pct,op=reset,default=15
Q 0.00 flask
R 0.00 food
S 0.00 augmentation
T 0.00 arcane_familiar
U 0.00 arcane_intellect
V 0.00 conjure_mana_gem
W 0.00 snapshot_stats
X 0.00 mirror_image
Y 0.00 frostbolt,if=variable.prepull_evo<=0
Z 0.00 evocation,if=variable.prepull_evo>0
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
a 0.00 call_action_list,name=shared_cds
b 0.00 call_action_list,name=essences
c 0.00 call_action_list,name=aoe,if=active_enemies>2
d 0.00 call_action_list,name=opener,if=variable.have_opened<=0
e 0.00 call_action_list,name=am_spam,if=variable.am_spam=1
f 0.00 call_action_list,name=cooldowns
g 0.00 call_action_list,name=rotation,if=variable.final_burn=0
h 0.00 call_action_list,name=final_burn,if=variable.final_burn=1
i 0.00 call_action_list,name=movement
actions.aoe
# count action,conditions
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
0.00 arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
0.00 mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
j 5.70 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
k 3.32 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
l 0.07 radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
m 6.14 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
n 2.84 arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
o 5.98 rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
0.00 presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
0.00 arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
0.00 supernova
p 13.18 arcane_orb,if=buff.arcane_charge.stack=0
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
q 160.02 arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
0.00 arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
r 58.46 arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
s 0.93 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.shared_cds
# count action,conditions
u 2.75 use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
v 2.84 use_items,if=buff.arcane_power.up
w 1.00 potion,if=buff.arcane_power.up
x 1.48 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
0.00 lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
y 1.84 berserking,if=buff.arcane_power.up
0.00 blood_fury,if=buff.arcane_power.up
0.00 fireblood,if=buff.arcane_power.up
0.00 ancestral_call,if=buff.arcane_power.up

Sample Sequence

045789ABGILMNPQRVXYkxmnvwyrprqqqqrqqqqrqqqqorqqqqurqqqqrprqqqqrqqjqqrqqqqrqqqqrqqqqrprqqqqrqmorqqqqrjprqqqqrqqqqrqqqqrprqqqqrqqqqrkmorprqqqqrqqqqnvrqqqqrprqujqqqrqqqqrqqqqrmorprqqqqrjqqqqrqqqqrprqqqqrqqqqrqskmorprqqqqrqqqqrqqqqrprqjqqqrqqqqrqqqqrmunvyrprqqqqrqjqqqorqqqqrprqqqqrqqqqrqxqqqrprqqqqrqqqqrqqqqrkmorprqqqqrqqqqrqqqqrqqqqr

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 prepull_evo Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat 4 have_opened Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat 5 have_opened Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat 7 final_burn Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat 8 rs_max_delay Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat 9 ap_max_delay Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat A rop_max_delay Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat B totm_max_delay Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat G barrage_mana_pct Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat I ap_minimum_mana_pct Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat L totm_max_charges Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat M aoe_totm_max_charges Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat N am_spam Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat P am_spam_evo_pct Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat Q flask Kyrian_Pelagos 67365.7/67366: 100% mana
Pre precombat R food Kyrian_Pelagos 67365.7/67366: 100% mana
Pre precombat V conjure_mana_gem Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat X mirror_image Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat Y frostbolt Fluffy_Pillow 67365.7/67366: 100% mana
0:00.000 aoe k radiant_spark Fluffy_Pillow 66365.7/67366: 99% mana
0:01.300 shared_cds x time_warp Fluffy_Pillow 72228.2/73309: 99% mana bloodlust, crimson_chorus, combat_meditation
0:01.300 aoe m touch_of_the_magi Fluffy_Pillow 70228.2/73309: 96% mana bloodlust, temporal_warp, crimson_chorus, combat_meditation
0:02.072 aoe n arcane_power Fluffy_Pillow 68860.1/73309: 94% mana bloodlust, arcane_charge(4), temporal_warp, crimson_chorus, combat_meditation
0:02.072 shared_cds v use_items Fluffy_Pillow 68860.1/73309: 94% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, crimson_chorus, combat_meditation
0:02.072 shared_cds w potion Fluffy_Pillow 68860.1/73309: 94% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, crimson_chorus, combat_meditation, gladiators_badge
0:02.072 shared_cds y berserking Fluffy_Pillow 68860.1/73309: 94% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, crimson_chorus, combat_meditation, potion_of_deathly_fixation, gladiators_badge
0:02.072 aoe r arcane_barrage Fluffy_Pillow 68860.1/73309: 94% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, crimson_chorus, combat_meditation, potion_of_deathly_fixation, gladiators_badge
0:02.828 aoe p arcane_orb Fluffy_Pillow 72900.9/73309: 99% mana bloodlust, berserking, arcane_power, rune_of_power, temporal_warp, crimson_chorus, combat_meditation, potion_of_deathly_fixation, gladiators_badge
0:03.582 aoe r arcane_barrage Fluffy_Pillow 73309.1/73309: 100% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, crimson_chorus, combat_meditation, potion_of_deathly_fixation, gladiators_badge
0:04.337 aoe q arcane_explosion Fluffy_Pillow 73309.1/73309: 100% mana bloodlust, berserking, arcane_power, rune_of_power, temporal_warp, crimson_chorus, combat_meditation, potion_of_deathly_fixation, gladiators_badge
0:05.091 aoe q arcane_explosion Fluffy_Pillow 71914.6/73309: 98% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, temporal_warp, crimson_chorus, combat_meditation, potion_of_deathly_fixation, gladiators_badge
0:05.846 aoe q arcane_explosion Fluffy_Pillow 70521.6/73309: 96% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, temporal_warp, crimson_chorus, combat_meditation, potion_of_deathly_fixation, gladiators_badge
0:06.600 aoe q arcane_explosion Fluffy_Pillow 69127.1/73309: 94% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, temporal_warp, crimson_chorus, combat_meditation, potion_of_deathly_fixation, gladiators_badge
0:07.354 aoe r arcane_barrage Fluffy_Pillow 67732.6/73309: 92% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, crimson_chorus, combat_meditation, potion_of_deathly_fixation, gladiators_badge
0:08.108 aoe q arcane_explosion Fluffy_Pillow 71770.5/73309: 98% mana bloodlust, berserking, arcane_power, rune_of_power, temporal_warp, crimson_chorus, combat_meditation, potion_of_deathly_fixation, gladiators_badge
0:08.862 aoe q arcane_explosion Fluffy_Pillow 70376.0/73309: 96% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, temporal_warp, crimson_chorus, combat_meditation, potion_of_deathly_fixation, gladiators_badge
0:09.618 aoe q arcane_explosion Fluffy_Pillow 63391.6/67366: 94% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:10.373 aoe q arcane_explosion Fluffy_Pillow 61908.8/67366: 92% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:11.128 aoe r arcane_barrage Fluffy_Pillow 60426.1/67366: 90% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:11.883 aoe q arcane_explosion Fluffy_Pillow 64137.9/67366: 95% mana bloodlust, berserking, arcane_power, rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:12.637 aoe q arcane_explosion Fluffy_Pillow 62653.8/67366: 93% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:13.393 aoe q arcane_explosion Fluffy_Pillow 61172.4/67366: 91% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:14.147 aoe q arcane_explosion Fluffy_Pillow 59688.2/67366: 89% mana bloodlust, arcane_charge(3), arcane_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:14.917 aoe o rune_of_power Fluffy_Pillow 58225.7/67366: 86% mana bloodlust, arcane_charge(4), arcane_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:15.688 aoe r arcane_barrage Fluffy_Pillow 59264.4/67366: 88% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:16.456 aoe q arcane_explosion Fluffy_Pillow 62993.8/67366: 94% mana bloodlust, arcane_power, rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:17.227 aoe q arcane_explosion Fluffy_Pillow 61532.6/67366: 91% mana bloodlust, arcane_charge, clearcasting, rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation
0:17.999 aoe q arcane_explosion Fluffy_Pillow 62572.7/67366: 93% mana bloodlust, arcane_charge(2), rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation
0:18.770 aoe q arcane_explosion Fluffy_Pillow 58611.5/67366: 87% mana bloodlust, arcane_charge(3), rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation
0:19.540 shared_cds u use_mana_gem Kyrian_Pelagos 54648.9/67366: 81% mana bloodlust, arcane_charge(4), rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation
0:19.540 aoe r arcane_barrage Fluffy_Pillow 61385.5/67366: 91% mana bloodlust, arcane_charge(4), rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation
0:20.311 aoe q arcane_explosion Fluffy_Pillow 65118.9/67366: 97% mana bloodlust, rune_of_power, temporal_warp, crimson_chorus(3), potion_of_deathly_fixation
0:21.081 aoe q arcane_explosion Fluffy_Pillow 61156.3/67366: 91% mana bloodlust, arcane_charge, rune_of_power, temporal_warp, crimson_chorus(3), potion_of_deathly_fixation
0:21.852 aoe q arcane_explosion Fluffy_Pillow 57195.1/67366: 85% mana bloodlust, arcane_charge(2), rune_of_power, temporal_warp, crimson_chorus(3), potion_of_deathly_fixation
0:22.623 aoe q arcane_explosion Fluffy_Pillow 53233.9/67366: 79% mana bloodlust, arcane_charge(3), rune_of_power, temporal_warp, crimson_chorus(3), potion_of_deathly_fixation
0:23.394 aoe r arcane_barrage Fluffy_Pillow 49272.7/67366: 73% mana bloodlust, arcane_charge(4), rune_of_power, temporal_warp, crimson_chorus(3), potion_of_deathly_fixation
0:24.165 aoe p arcane_orb Fluffy_Pillow 53006.1/67366: 79% mana bloodlust, rune_of_power, temporal_warp, crimson_chorus(3), potion_of_deathly_fixation
0:24.934 aoe r arcane_barrage Fluffy_Pillow 53542.2/67366: 79% mana bloodlust, arcane_charge(4), rune_of_power, temporal_warp, crimson_chorus(3), potion_of_deathly_fixation
0:25.705 aoe q arcane_explosion Fluffy_Pillow 57275.6/67366: 85% mana bloodlust, rune_of_power, temporal_warp, crimson_chorus(3), potion_of_deathly_fixation
0:26.477 aoe q arcane_explosion Fluffy_Pillow 53315.7/67366: 79% mana bloodlust, arcane_charge, rune_of_power, temporal_warp, crimson_chorus(3), potion_of_deathly_fixation
0:27.247 aoe q arcane_explosion Fluffy_Pillow 49353.1/67366: 73% mana bloodlust, arcane_charge(2), clearcasting, rune_of_power, temporal_warp, crimson_chorus(3)
0:28.018 aoe q arcane_explosion Fluffy_Pillow 50391.9/67366: 75% mana bloodlust, arcane_charge(3), temporal_warp, crimson_chorus(3)
0:28.788 aoe r arcane_barrage Fluffy_Pillow 46429.3/67366: 69% mana bloodlust, arcane_charge(4), clearcasting, temporal_warp, crimson_chorus(3)
0:29.559 aoe q arcane_explosion Fluffy_Pillow 50162.7/67366: 74% mana bloodlust, clearcasting, temporal_warp, crimson_chorus(3)
0:30.330 aoe q arcane_explosion Fluffy_Pillow 51201.5/67366: 76% mana bloodlust, arcane_charge, temporal_warp
0:31.100 aoe j radiant_spark Fluffy_Pillow 47239.0/67366: 70% mana bloodlust, arcane_charge(2), temporal_warp
0:32.064 aoe q arcane_explosion Fluffy_Pillow 47537.8/67366: 71% mana bloodlust, arcane_charge(2), temporal_warp
0:32.836 aoe q arcane_explosion Fluffy_Pillow 43577.9/67366: 65% mana bloodlust, arcane_charge(3), temporal_warp
0:33.604 aoe r arcane_barrage Fluffy_Pillow 39612.6/67366: 59% mana bloodlust, arcane_charge(4), temporal_warp
0:34.375 aoe q arcane_explosion Fluffy_Pillow 43346.0/67366: 64% mana bloodlust, temporal_warp
0:35.145 aoe q arcane_explosion Fluffy_Pillow 39383.5/67366: 58% mana bloodlust, arcane_charge, clearcasting, temporal_warp
0:35.916 aoe q arcane_explosion Fluffy_Pillow 40422.3/67366: 60% mana bloodlust, arcane_charge(2), temporal_warp
0:36.686 aoe q arcane_explosion Fluffy_Pillow 36459.7/67366: 54% mana bloodlust, arcane_charge(3), temporal_warp
0:37.457 aoe r arcane_barrage Fluffy_Pillow 32498.5/67366: 48% mana bloodlust, arcane_charge(4), temporal_warp
0:38.227 aoe q arcane_explosion Fluffy_Pillow 36230.5/67366: 54% mana bloodlust, temporal_warp
0:38.999 aoe q arcane_explosion Fluffy_Pillow 32270.7/67366: 48% mana bloodlust, arcane_charge, temporal_warp
0:39.769 aoe q arcane_explosion Fluffy_Pillow 28308.1/67366: 42% mana bloodlust, arcane_charge(2), temporal_warp
0:40.538 aoe q arcane_explosion Fluffy_Pillow 24344.2/67366: 36% mana bloodlust, arcane_charge(3), temporal_warp
0:41.309 aoe r arcane_barrage Fluffy_Pillow 20382.9/67366: 30% mana arcane_charge(4)
0:42.609 aoe q arcane_explosion Fluffy_Pillow 24829.1/67366: 37% mana
0:43.910 aoe q arcane_explosion Fluffy_Pillow 21581.9/67366: 32% mana arcane_charge
0:45.210 aoe q arcane_explosion Fluffy_Pillow 18333.5/67366: 27% mana arcane_charge(2)
0:46.508 aoe q arcane_explosion Fluffy_Pillow 15082.3/67366: 22% mana arcane_charge(3)
0:47.807 aoe r arcane_barrage Fluffy_Pillow 11832.4/67366: 18% mana arcane_charge(4)
0:49.107 aoe p arcane_orb Fluffy_Pillow 16278.6/67366: 24% mana
0:50.407 aoe r arcane_barrage Fluffy_Pillow 17530.1/67366: 26% mana arcane_charge(4)
0:51.707 aoe q arcane_explosion Fluffy_Pillow 21976.2/67366: 33% mana
0:53.007 aoe q arcane_explosion Fluffy_Pillow 18727.7/67366: 28% mana arcane_charge, clearcasting
0:54.309 aoe q arcane_explosion Fluffy_Pillow 20481.9/67366: 30% mana arcane_charge(2)
0:55.608 aoe q arcane_explosion Fluffy_Pillow 17232.1/67366: 26% mana arcane_charge(3)
0:56.907 aoe r arcane_barrage Fluffy_Pillow 13982.2/67366: 21% mana arcane_charge(4)
0:58.207 aoe q arcane_explosion Fluffy_Pillow 18428.4/67366: 27% mana
0:59.508 aoe m touch_of_the_magi Fluffy_Pillow 15181.2/67366: 23% mana arcane_charge, clearcasting
1:00.808 aoe o rune_of_power Fluffy_Pillow 14432.7/67366: 21% mana arcane_charge(4), clearcasting, crimson_chorus
1:02.106 aoe r arcane_barrage Fluffy_Pillow 16181.6/67366: 24% mana arcane_charge(4), clearcasting, rune_of_power, crimson_chorus
1:03.404 aoe q arcane_explosion Fluffy_Pillow 20625.0/67366: 31% mana clearcasting, rune_of_power, crimson_chorus
1:04.703 aoe q arcane_explosion Fluffy_Pillow 22375.2/67366: 33% mana arcane_charge, rune_of_power, crimson_chorus
1:06.000 aoe q arcane_explosion Fluffy_Pillow 19122.6/67366: 28% mana arcane_charge(2), rune_of_power, crimson_chorus
1:07.299 aoe q arcane_explosion Fluffy_Pillow 15872.8/67366: 24% mana arcane_charge(3), rune_of_power, crimson_chorus
1:08.598 aoe r arcane_barrage Fluffy_Pillow 12623.0/67366: 19% mana arcane_charge(4), clearcasting, rune_of_power, crimson_chorus
1:09.899 aoe j radiant_spark Fluffy_Pillow 17070.4/67366: 25% mana clearcasting, rune_of_power, crimson_chorus
1:11.200 aoe p arcane_orb Fluffy_Pillow 19395.8/73309: 26% mana clearcasting, rune_of_power, crimson_chorus(2), combat_meditation
1:12.498 aoe r arcane_barrage Fluffy_Pillow 20798.9/73309: 28% mana arcane_charge(4), clearcasting, rune_of_power, crimson_chorus(2), combat_meditation
1:13.799 aoe q arcane_explosion Fluffy_Pillow 25638.7/73309: 35% mana clearcasting, rune_of_power, crimson_chorus(2), combat_meditation
1:15.100 aoe q arcane_explosion Fluffy_Pillow 27546.3/73309: 38% mana arcane_charge, crimson_chorus(2), combat_meditation
1:16.400 aoe q arcane_explosion Fluffy_Pillow 24452.3/73309: 33% mana arcane_charge(2), clearcasting, crimson_chorus(2), combat_meditation
1:17.700 aoe q arcane_explosion Fluffy_Pillow 26358.3/73309: 36% mana arcane_charge(3), crimson_chorus(2), combat_meditation
1:18.998 aoe r arcane_barrage Fluffy_Pillow 23261.4/73309: 32% mana arcane_charge(4), crimson_chorus(2), combat_meditation
1:20.297 aoe q arcane_explosion Fluffy_Pillow 25820.3/67366: 38% mana crimson_chorus(2)
1:21.596 aoe q arcane_explosion Fluffy_Pillow 22570.5/67366: 34% mana arcane_charge, crimson_chorus(3)
1:22.895 aoe q arcane_explosion Fluffy_Pillow 19320.7/67366: 29% mana arcane_charge(2), crimson_chorus(3)
1:24.195 aoe q arcane_explosion Fluffy_Pillow 16072.2/67366: 24% mana arcane_charge(3), crimson_chorus(3)
1:25.493 aoe r arcane_barrage Fluffy_Pillow 12821.0/67366: 19% mana arcane_charge(4), crimson_chorus(3)
1:26.793 aoe q arcane_explosion Fluffy_Pillow 17267.1/67366: 26% mana crimson_chorus(3)
1:28.094 aoe q arcane_explosion Fluffy_Pillow 14020.0/67366: 21% mana arcane_charge, crimson_chorus(3)
1:29.392 aoe q arcane_explosion Fluffy_Pillow 10768.8/67366: 16% mana arcane_charge(2), crimson_chorus(3)
1:30.692 aoe q arcane_explosion Fluffy_Pillow 7520.3/67366: 11% mana arcane_charge(3), crimson_chorus(3)
1:31.991 aoe r arcane_barrage Fluffy_Pillow 4270.5/67366: 6% mana arcane_charge(4)
1:33.291 aoe p arcane_orb Fluffy_Pillow 8716.6/67366: 13% mana
1:34.592 aoe r arcane_barrage Fluffy_Pillow 9969.5/67366: 15% mana arcane_charge(4)
1:35.890 aoe q arcane_explosion Fluffy_Pillow 14412.9/67366: 21% mana
1:37.189 aoe q arcane_explosion Fluffy_Pillow 11163.1/67366: 17% mana arcane_charge, clearcasting
1:38.489 aoe q arcane_explosion Fluffy_Pillow 12914.6/67366: 19% mana arcane_charge(2)
1:39.787 aoe q arcane_explosion Fluffy_Pillow 9663.4/67366: 14% mana arcane_charge(3)
1:41.087 aoe r arcane_barrage Fluffy_Pillow 6414.9/67366: 10% mana arcane_charge(4), clearcasting
1:42.387 aoe q arcane_explosion Fluffy_Pillow 10861.0/67366: 16% mana clearcasting
1:43.687 aoe q arcane_explosion Fluffy_Pillow 12612.5/67366: 19% mana arcane_charge
1:44.987 aoe q arcane_explosion Fluffy_Pillow 9364.0/67366: 14% mana arcane_charge(2), clearcasting
1:46.287 aoe q arcane_explosion Fluffy_Pillow 11115.6/67366: 17% mana arcane_charge(3)
1:47.589 aoe r arcane_barrage Fluffy_Pillow 7869.8/67366: 12% mana arcane_charge(4), clearcasting
1:48.887 aoe k radiant_spark Fluffy_Pillow 12313.2/67366: 18% mana clearcasting
1:50.187 aoe m touch_of_the_magi Fluffy_Pillow 13064.7/67366: 19% mana clearcasting
1:51.487 aoe o rune_of_power Fluffy_Pillow 12316.2/67366: 18% mana arcane_charge(4), clearcasting
1:52.785 aoe r arcane_barrage Fluffy_Pillow 14065.0/67366: 21% mana arcane_charge(4), clearcasting, rune_of_power
1:54.084 aoe p arcane_orb Fluffy_Pillow 18509.8/67366: 27% mana clearcasting, rune_of_power
1:55.383 aoe r arcane_barrage Fluffy_Pillow 19760.0/67366: 29% mana arcane_charge(4), clearcasting, rune_of_power
1:56.681 aoe q arcane_explosion Fluffy_Pillow 24203.4/67366: 36% mana clearcasting, rune_of_power
1:57.980 aoe q arcane_explosion Fluffy_Pillow 25953.6/67366: 39% mana arcane_charge, rune_of_power
1:59.278 aoe q arcane_explosion Fluffy_Pillow 22702.4/67366: 34% mana arcane_charge(2), rune_of_power
2:00.576 aoe q arcane_explosion Fluffy_Pillow 19451.2/67366: 29% mana arcane_charge(3), clearcasting, rune_of_power
2:01.877 aoe r arcane_barrage Fluffy_Pillow 21204.1/67366: 31% mana arcane_charge(4), rune_of_power
2:03.176 aoe q arcane_explosion Fluffy_Pillow 25648.9/67366: 38% mana rune_of_power, crimson_chorus
2:04.475 aoe q arcane_explosion Fluffy_Pillow 22399.0/67366: 33% mana arcane_charge, rune_of_power, crimson_chorus
2:05.775 aoe q arcane_explosion Fluffy_Pillow 19150.5/67366: 28% mana arcane_charge(2), crimson_chorus
2:07.073 aoe q arcane_explosion Fluffy_Pillow 15899.3/67366: 24% mana arcane_charge(3), crimson_chorus
2:08.374 aoe n arcane_power Fluffy_Pillow 12652.2/67366: 19% mana arcane_charge(4), crimson_chorus
2:08.374 shared_cds v use_items Fluffy_Pillow 12652.2/67366: 19% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus
2:08.374 aoe r arcane_barrage Fluffy_Pillow 12652.2/67366: 19% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus, gladiators_badge
2:09.675 aoe q arcane_explosion Fluffy_Pillow 17099.7/67366: 25% mana arcane_power, rune_of_power, crimson_chorus, gladiators_badge
2:10.973 aoe q arcane_explosion Fluffy_Pillow 16348.5/67366: 24% mana arcane_charge, arcane_power, rune_of_power, crimson_chorus, gladiators_badge
2:12.274 aoe q arcane_explosion Fluffy_Pillow 15601.4/67366: 23% mana arcane_charge(2), arcane_power, rune_of_power, crimson_chorus, gladiators_badge
2:13.574 aoe q arcane_explosion Fluffy_Pillow 14852.9/67366: 22% mana arcane_charge(3), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:14.872 aoe r arcane_barrage Fluffy_Pillow 14101.7/67366: 21% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:16.173 aoe p arcane_orb Fluffy_Pillow 18549.2/67366: 28% mana arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:17.473 aoe r arcane_barrage Fluffy_Pillow 20050.7/67366: 30% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:18.772 aoe q arcane_explosion Fluffy_Pillow 24495.5/67366: 36% mana arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:20.072 shared_cds u use_mana_gem Kyrian_Pelagos 23747.0/67366: 35% mana arcane_charge, arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:20.072 aoe j radiant_spark Fluffy_Pillow 30483.5/67366: 45% mana arcane_charge, arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:21.479 aoe q arcane_explosion Fluffy_Pillow 34691.8/73309: 47% mana arcane_charge, arcane_power, crimson_chorus(2), combat_meditation, gladiators_badge
2:22.780 aoe q arcane_explosion Fluffy_Pillow 34099.3/73309: 47% mana arcane_charge(2), arcane_power, crimson_chorus(3), combat_meditation, gladiators_badge
2:24.079 aoe q arcane_explosion Fluffy_Pillow 33503.9/73309: 46% mana arcane_charge(3), crimson_chorus(3), combat_meditation
2:25.380 aoe r arcane_barrage Fluffy_Pillow 30411.4/73309: 41% mana arcane_charge(4), crimson_chorus(3), combat_meditation
2:26.679 aoe q arcane_explosion Fluffy_Pillow 35248.3/73309: 48% mana crimson_chorus(3), combat_meditation
2:27.979 aoe q arcane_explosion Fluffy_Pillow 32154.3/73309: 44% mana arcane_charge, crimson_chorus(3), combat_meditation
2:29.277 aoe q arcane_explosion Fluffy_Pillow 29057.5/73309: 40% mana arcane_charge(2), crimson_chorus(3), combat_meditation
2:30.577 aoe q arcane_explosion Fluffy_Pillow 23858.5/67366: 35% mana arcane_charge(3), clearcasting, crimson_chorus(3)
2:31.875 aoe r arcane_barrage Fluffy_Pillow 25607.4/67366: 38% mana arcane_charge(4), crimson_chorus(3)
2:33.172 aoe q arcane_explosion Fluffy_Pillow 30049.4/67366: 45% mana
2:34.471 aoe q arcane_explosion Fluffy_Pillow 26799.6/67366: 40% mana arcane_charge
2:35.771 aoe q arcane_explosion Fluffy_Pillow 23551.1/67366: 35% mana arcane_charge(2)
2:37.070 aoe q arcane_explosion Fluffy_Pillow 20301.3/67366: 30% mana arcane_charge(3)
2:38.370 aoe r arcane_barrage Fluffy_Pillow 17052.8/67366: 25% mana arcane_charge(4)
2:39.667 aoe m touch_of_the_magi Fluffy_Pillow 21494.9/67366: 32% mana
2:40.968 aoe o rune_of_power Fluffy_Pillow 20747.7/67366: 31% mana arcane_charge(4)
2:42.266 aoe r arcane_barrage Fluffy_Pillow 22496.6/67366: 33% mana arcane_charge(4), rune_of_power
2:43.565 aoe p arcane_orb Fluffy_Pillow 26941.3/67366: 40% mana rune_of_power
2:44.864 aoe r arcane_barrage Fluffy_Pillow 28191.5/67366: 42% mana arcane_charge(4), rune_of_power
2:46.163 aoe q arcane_explosion Fluffy_Pillow 32636.3/67366: 48% mana rune_of_power
2:47.463 aoe q arcane_explosion Fluffy_Pillow 29387.8/67366: 44% mana arcane_charge, rune_of_power
2:48.762 aoe q arcane_explosion Fluffy_Pillow 26138.0/67366: 39% mana arcane_charge(2), rune_of_power
2:50.060 aoe q arcane_explosion Fluffy_Pillow 22886.8/67366: 34% mana arcane_charge(3), rune_of_power
2:51.359 aoe r arcane_barrage Fluffy_Pillow 19636.9/67366: 29% mana arcane_charge(4), rune_of_power
2:52.658 aoe j radiant_spark Fluffy_Pillow 24081.7/67366: 36% mana rune_of_power
2:53.959 aoe q arcane_explosion Fluffy_Pillow 24834.6/67366: 37% mana rune_of_power
2:55.259 aoe q arcane_explosion Fluffy_Pillow 21586.1/67366: 32% mana arcane_charge
2:56.558 aoe q arcane_explosion Fluffy_Pillow 18336.3/67366: 27% mana arcane_charge(2)
2:57.858 aoe q arcane_explosion Fluffy_Pillow 15087.8/67366: 22% mana arcane_charge(3), clearcasting
2:59.158 aoe r arcane_barrage Fluffy_Pillow 16839.3/67366: 25% mana arcane_charge(4)
3:00.455 aoe q arcane_explosion Fluffy_Pillow 21281.4/67366: 32% mana
3:01.754 aoe q arcane_explosion Fluffy_Pillow 18031.5/67366: 27% mana arcane_charge
3:03.054 aoe q arcane_explosion Fluffy_Pillow 14783.0/67366: 22% mana arcane_charge(2)
3:04.353 aoe q arcane_explosion Fluffy_Pillow 11533.2/67366: 17% mana arcane_charge(3), crimson_chorus
3:05.654 aoe r arcane_barrage Fluffy_Pillow 8286.1/67366: 12% mana arcane_charge(4), clearcasting, crimson_chorus
3:06.954 aoe p arcane_orb Fluffy_Pillow 12732.2/67366: 19% mana clearcasting, crimson_chorus
3:08.252 aoe r arcane_barrage Fluffy_Pillow 13981.0/67366: 21% mana arcane_charge(4), clearcasting, crimson_chorus
3:09.551 aoe q arcane_explosion Fluffy_Pillow 18425.8/67366: 27% mana clearcasting, crimson_chorus
3:10.851 aoe q arcane_explosion Fluffy_Pillow 20177.3/67366: 30% mana arcane_charge, crimson_chorus
3:12.150 aoe q arcane_explosion Fluffy_Pillow 16927.5/67366: 25% mana arcane_charge(2), crimson_chorus
3:13.450 aoe q arcane_explosion Fluffy_Pillow 13679.0/67366: 20% mana arcane_charge(3), crimson_chorus(2)
3:14.749 aoe r arcane_barrage Fluffy_Pillow 10429.1/67366: 15% mana arcane_charge(4), crimson_chorus(2)
3:16.049 aoe q arcane_explosion Fluffy_Pillow 14875.3/67366: 22% mana crimson_chorus(2)
3:17.348 aoe q arcane_explosion Fluffy_Pillow 11625.4/67366: 17% mana arcane_charge, crimson_chorus(2)
3:18.647 aoe q arcane_explosion Fluffy_Pillow 8375.6/67366: 12% mana arcane_charge(2), crimson_chorus(2)
3:19.946 aoe q arcane_explosion Fluffy_Pillow 5125.8/67366: 8% mana arcane_charge(3), crimson_chorus(2)
3:21.247 aoe r arcane_barrage Fluffy_Pillow 1878.6/67366: 3% mana arcane_charge(4), crimson_chorus(2)
3:22.549 aoe q arcane_explosion Fluffy_Pillow 6327.4/67366: 9% mana crimson_chorus(2)
3:23.848 aoe s evocation Kyrian_Pelagos 3077.6/67366: 5% mana arcane_charge, crimson_chorus(3)
3:28.167 aoe k radiant_spark Fluffy_Pillow 60285.9/67366: 89% mana arcane_charge, crimson_chorus(3)
3:29.467 aoe m touch_of_the_magi Fluffy_Pillow 66422.5/73309: 91% mana arcane_charge, crimson_chorus(3), combat_meditation
3:30.766 aoe o rune_of_power Fluffy_Pillow 65827.1/73309: 90% mana arcane_charge(4), crimson_chorus(3), combat_meditation
3:32.065 aoe r arcane_barrage Fluffy_Pillow 67731.7/73309: 92% mana arcane_charge(4), rune_of_power, crimson_chorus(3), combat_meditation
3:33.364 aoe p arcane_orb Fluffy_Pillow 72568.6/73309: 99% mana rune_of_power, combat_meditation
3:34.665 aoe r arcane_barrage Fluffy_Pillow 73309.1/73309: 100% mana arcane_charge(4), rune_of_power, combat_meditation
3:35.964 aoe q arcane_explosion Fluffy_Pillow 73309.1/73309: 100% mana rune_of_power, combat_meditation
3:37.262 aoe q arcane_explosion Fluffy_Pillow 70212.2/73309: 96% mana arcane_charge, clearcasting, rune_of_power, combat_meditation
3:38.563 aoe q arcane_explosion Fluffy_Pillow 66272.8/67366: 98% mana arcane_charge(2), rune_of_power
3:39.862 aoe q arcane_explosion Fluffy_Pillow 63022.9/67366: 94% mana arcane_charge(3), rune_of_power
3:41.161 aoe r arcane_barrage Fluffy_Pillow 59773.1/67366: 89% mana arcane_charge(4), rune_of_power
3:42.462 aoe q arcane_explosion Fluffy_Pillow 64220.6/67366: 95% mana rune_of_power
3:43.760 aoe q arcane_explosion Fluffy_Pillow 60969.4/67366: 91% mana arcane_charge, clearcasting, rune_of_power
3:45.059 aoe q arcane_explosion Fluffy_Pillow 62719.5/67366: 93% mana arcane_charge(2)
3:46.359 aoe q arcane_explosion Fluffy_Pillow 59471.0/67366: 88% mana arcane_charge(3), clearcasting
3:47.659 aoe r arcane_barrage Fluffy_Pillow 61222.6/67366: 91% mana arcane_charge(4)
3:48.957 aoe q arcane_explosion Fluffy_Pillow 65666.0/67366: 97% mana
3:50.255 aoe q arcane_explosion Fluffy_Pillow 62414.8/67366: 93% mana arcane_charge
3:51.554 aoe q arcane_explosion Fluffy_Pillow 59165.0/67366: 88% mana arcane_charge(2), clearcasting
3:52.853 aoe q arcane_explosion Fluffy_Pillow 60915.1/67366: 90% mana arcane_charge(3)
3:54.150 aoe r arcane_barrage Fluffy_Pillow 57662.6/67366: 86% mana arcane_charge(4)
3:55.449 aoe p arcane_orb Fluffy_Pillow 62107.4/67366: 92% mana
3:56.749 aoe r arcane_barrage Fluffy_Pillow 63358.9/67366: 94% mana arcane_charge(4)
3:58.049 aoe q arcane_explosion Fluffy_Pillow 67365.7/67366: 100% mana
3:59.349 aoe j radiant_spark Fluffy_Pillow 64117.2/67366: 95% mana arcane_charge
4:00.760 aoe q arcane_explosion Fluffy_Pillow 65018.3/67366: 97% mana arcane_charge
4:02.059 aoe q arcane_explosion Fluffy_Pillow 61768.4/67366: 92% mana arcane_charge(2)
4:03.359 aoe q arcane_explosion Fluffy_Pillow 58520.0/67366: 87% mana arcane_charge(3), clearcasting
4:04.659 aoe r arcane_barrage Fluffy_Pillow 60271.5/67366: 89% mana arcane_charge(4), crimson_chorus
4:05.957 aoe q arcane_explosion Fluffy_Pillow 64714.9/67366: 96% mana crimson_chorus
4:07.256 aoe q arcane_explosion Fluffy_Pillow 61465.1/67366: 91% mana arcane_charge, clearcasting, crimson_chorus
4:08.556 aoe q arcane_explosion Fluffy_Pillow 63216.6/67366: 94% mana arcane_charge(2), crimson_chorus
4:09.856 aoe q arcane_explosion Fluffy_Pillow 59968.1/67366: 89% mana arcane_charge(3), crimson_chorus
4:11.154 aoe r arcane_barrage Fluffy_Pillow 56716.9/67366: 84% mana arcane_charge(4), clearcasting, crimson_chorus
4:12.453 aoe q arcane_explosion Fluffy_Pillow 61161.7/67366: 91% mana clearcasting, crimson_chorus
4:13.752 aoe q arcane_explosion Fluffy_Pillow 62911.8/67366: 93% mana arcane_charge, crimson_chorus(2)
4:15.053 aoe q arcane_explosion Fluffy_Pillow 59664.7/67366: 89% mana arcane_charge(2), crimson_chorus(2)
4:16.352 aoe q arcane_explosion Fluffy_Pillow 56414.9/67366: 84% mana arcane_charge(3), crimson_chorus(2)
4:17.652 aoe r arcane_barrage Fluffy_Pillow 53166.4/67366: 79% mana arcane_charge(4), clearcasting, crimson_chorus(2)
4:18.951 aoe m touch_of_the_magi Fluffy_Pillow 57611.2/67366: 86% mana clearcasting, crimson_chorus(2)
4:20.250 shared_cds u use_mana_gem Kyrian_Pelagos 56861.3/67366: 84% mana arcane_charge(4), clearcasting, crimson_chorus(2)
4:20.250 aoe n arcane_power Fluffy_Pillow 63597.9/67366: 94% mana arcane_charge(4), clearcasting, crimson_chorus(2)
4:20.250 shared_cds v use_items Fluffy_Pillow 63597.9/67366: 94% mana arcane_charge(4), arcane_power, clearcasting, rune_of_power, crimson_chorus(2)
4:20.250 shared_cds y berserking Fluffy_Pillow 63597.9/67366: 94% mana arcane_charge(4), arcane_power, clearcasting, rune_of_power, crimson_chorus(2), gladiators_badge
4:20.250 aoe r arcane_barrage Fluffy_Pillow 63597.9/67366: 94% mana berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, crimson_chorus(2), gladiators_badge
4:21.433 aoe p arcane_orb Fluffy_Pillow 67365.7/67366: 100% mana berserking, arcane_power, clearcasting, rune_of_power, crimson_chorus(2), gladiators_badge
4:22.617 aoe r arcane_barrage Fluffy_Pillow 67365.7/67366: 100% mana berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, crimson_chorus(2), gladiators_badge
4:23.801 aoe q arcane_explosion Fluffy_Pillow 67365.7/67366: 100% mana berserking, arcane_power, clearcasting, rune_of_power, crimson_chorus(3), gladiators_badge
4:24.983 aoe q arcane_explosion Fluffy_Pillow 67365.7/67366: 100% mana berserking, arcane_charge, arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
4:26.165 aoe q arcane_explosion Fluffy_Pillow 66458.2/67366: 99% mana berserking, arcane_charge(2), arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
4:27.349 aoe q arcane_explosion Fluffy_Pillow 65553.5/67366: 97% mana berserking, arcane_charge(3), arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
4:28.532 aoe r arcane_barrage Fluffy_Pillow 64647.3/67366: 96% mana berserking, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
4:29.714 aoe q arcane_explosion Fluffy_Pillow 67365.7/67366: 100% mana berserking, arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
4:30.897 aoe j radiant_spark Fluffy_Pillow 66459.6/67366: 99% mana berserking, arcane_charge, arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
4:32.079 aoe q arcane_explosion Fluffy_Pillow 72770.9/73309: 99% mana berserking, arcane_charge, arcane_power, rune_of_power, crimson_chorus(3), combat_meditation, gladiators_badge
4:33.262 aoe q arcane_explosion Fluffy_Pillow 72005.4/73309: 98% mana arcane_charge(2), arcane_power, crimson_chorus(3), combat_meditation, gladiators_badge
4:34.561 aoe q arcane_explosion Fluffy_Pillow 71410.0/73309: 97% mana arcane_charge(3), arcane_power, combat_meditation, gladiators_badge
4:35.859 aoe o rune_of_power Fluffy_Pillow 70813.1/73309: 97% mana arcane_charge(4), combat_meditation
4:37.158 aoe r arcane_barrage Fluffy_Pillow 72717.6/73309: 99% mana arcane_charge(4), rune_of_power, combat_meditation
4:38.458 aoe q arcane_explosion Fluffy_Pillow 73309.1/73309: 100% mana rune_of_power, combat_meditation
4:39.757 aoe q arcane_explosion Fluffy_Pillow 70213.7/73309: 96% mana arcane_charge, rune_of_power, combat_meditation
4:41.055 aoe q arcane_explosion Fluffy_Pillow 61675.4/67366: 92% mana arcane_charge(2), rune_of_power
4:42.355 aoe q arcane_explosion Fluffy_Pillow 58426.9/67366: 87% mana arcane_charge(3), rune_of_power
4:43.656 aoe r arcane_barrage Fluffy_Pillow 55179.8/67366: 82% mana arcane_charge(4), rune_of_power
4:44.955 aoe p arcane_orb Fluffy_Pillow 59624.6/67366: 89% mana rune_of_power
4:46.255 aoe r arcane_barrage Fluffy_Pillow 60876.1/67366: 90% mana arcane_charge(4), rune_of_power
4:47.554 aoe q arcane_explosion Fluffy_Pillow 65320.9/67366: 97% mana rune_of_power
4:48.854 aoe q arcane_explosion Fluffy_Pillow 62072.4/67366: 92% mana arcane_charge, rune_of_power
4:50.155 aoe q arcane_explosion Fluffy_Pillow 58825.2/67366: 87% mana arcane_charge(2)
4:51.454 aoe q arcane_explosion Fluffy_Pillow 55575.4/67366: 82% mana arcane_charge(3)
4:52.753 aoe r arcane_barrage Fluffy_Pillow 52325.6/67366: 78% mana arcane_charge(4)
4:54.052 aoe q arcane_explosion Fluffy_Pillow 56770.4/67366: 84% mana
4:55.351 aoe q arcane_explosion Fluffy_Pillow 53520.5/67366: 79% mana arcane_charge, clearcasting
4:56.650 aoe q arcane_explosion Fluffy_Pillow 55270.7/67366: 82% mana arcane_charge(2)
4:57.951 aoe q arcane_explosion Fluffy_Pillow 52023.5/67366: 77% mana arcane_charge(3)
4:59.249 aoe r arcane_barrage Fluffy_Pillow 48772.3/67366: 72% mana arcane_charge(4)
5:00.549 aoe q arcane_explosion Fluffy_Pillow 53218.5/67366: 79% mana
5:01.850 shared_cds x time_warp Fluffy_Pillow 49971.3/67366: 74% mana arcane_charge
5:01.850 aoe q arcane_explosion Fluffy_Pillow 47971.3/67366: 71% mana arcane_charge, temporal_warp
5:02.849 aoe q arcane_explosion Fluffy_Pillow 44317.3/67366: 66% mana arcane_charge(2), temporal_warp
5:03.848 aoe q arcane_explosion Fluffy_Pillow 40663.3/67366: 60% mana arcane_charge(3), temporal_warp
5:04.848 aoe r arcane_barrage Fluffy_Pillow 37010.6/67366: 55% mana arcane_charge(4), temporal_warp, crimson_chorus
5:05.848 aoe p arcane_orb Fluffy_Pillow 41052.5/67366: 61% mana temporal_warp, crimson_chorus
5:06.847 aoe r arcane_barrage Fluffy_Pillow 41898.5/67366: 62% mana arcane_charge(4), temporal_warp, crimson_chorus
5:07.848 aoe q arcane_explosion Fluffy_Pillow 45941.8/67366: 68% mana temporal_warp, crimson_chorus
5:08.847 aoe q arcane_explosion Fluffy_Pillow 42287.8/67366: 63% mana arcane_charge, temporal_warp, crimson_chorus
5:09.848 aoe q arcane_explosion Fluffy_Pillow 38636.4/67366: 57% mana arcane_charge(2), temporal_warp, crimson_chorus
5:10.847 aoe q arcane_explosion Fluffy_Pillow 34982.4/67366: 52% mana arcane_charge(3), temporal_warp, crimson_chorus
5:11.849 aoe r arcane_barrage Fluffy_Pillow 31332.4/67366: 47% mana arcane_charge(4), temporal_warp, crimson_chorus
5:12.850 aoe q arcane_explosion Fluffy_Pillow 35375.7/67366: 53% mana temporal_warp, crimson_chorus
5:13.849 aoe q arcane_explosion Fluffy_Pillow 31721.6/67366: 47% mana arcane_charge, clearcasting, temporal_warp, crimson_chorus(2)
5:14.850 aoe q arcane_explosion Fluffy_Pillow 33070.3/67366: 49% mana arcane_charge(2), temporal_warp, crimson_chorus(2)
5:15.851 aoe q arcane_explosion Fluffy_Pillow 29419.0/67366: 44% mana arcane_charge(3), temporal_warp, crimson_chorus(2)
5:16.851 aoe r arcane_barrage Fluffy_Pillow 25766.3/67366: 38% mana arcane_charge(4), temporal_warp, crimson_chorus(2)
5:17.850 aoe q arcane_explosion Fluffy_Pillow 29806.9/67366: 44% mana temporal_warp, crimson_chorus(2)
5:18.850 aoe q arcane_explosion Fluffy_Pillow 26154.2/67366: 39% mana arcane_charge, temporal_warp, crimson_chorus(2)
5:19.851 aoe q arcane_explosion Fluffy_Pillow 22502.9/67366: 33% mana arcane_charge(2), temporal_warp, crimson_chorus(2)
5:20.853 aoe q arcane_explosion Fluffy_Pillow 18852.9/67366: 28% mana arcane_charge(3), temporal_warp, crimson_chorus(2)
5:21.852 aoe r arcane_barrage Fluffy_Pillow 15198.8/67366: 23% mana arcane_charge(4), temporal_warp, crimson_chorus(2)
5:22.854 aoe k radiant_spark Fluffy_Pillow 19243.5/67366: 29% mana temporal_warp, crimson_chorus(2)
5:23.854 aoe m touch_of_the_magi Fluffy_Pillow 19590.8/67366: 29% mana temporal_warp, crimson_chorus(3)
5:24.854 aoe o rune_of_power Fluffy_Pillow 18438.1/67366: 27% mana arcane_charge(4), temporal_warp, crimson_chorus(3)
5:25.855 aoe r arcane_barrage Fluffy_Pillow 19786.8/67366: 29% mana arcane_charge(4), rune_of_power, temporal_warp, crimson_chorus(3)
5:26.855 aoe p arcane_orb Fluffy_Pillow 23828.7/67366: 35% mana rune_of_power, temporal_warp, crimson_chorus(3)
5:27.856 aoe r arcane_barrage Fluffy_Pillow 24677.4/67366: 37% mana arcane_charge(4), rune_of_power, temporal_warp, crimson_chorus(3)
5:28.857 aoe q arcane_explosion Fluffy_Pillow 28720.7/67366: 43% mana rune_of_power, temporal_warp, crimson_chorus(3)
5:29.859 aoe q arcane_explosion Fluffy_Pillow 25070.7/67366: 37% mana arcane_charge, rune_of_power, temporal_warp, crimson_chorus(3)
5:30.858 aoe q arcane_explosion Fluffy_Pillow 21416.6/67366: 32% mana arcane_charge(2), clearcasting, rune_of_power, temporal_warp, crimson_chorus(3)
5:31.859 aoe q arcane_explosion Fluffy_Pillow 22765.3/67366: 34% mana arcane_charge(3), rune_of_power, temporal_warp, crimson_chorus(3)
5:32.860 aoe r arcane_barrage Fluffy_Pillow 19114.0/67366: 28% mana arcane_charge(4), rune_of_power, temporal_warp, crimson_chorus(3)
5:33.861 aoe q arcane_explosion Fluffy_Pillow 23157.2/67366: 34% mana rune_of_power, temporal_warp
5:34.862 aoe q arcane_explosion Fluffy_Pillow 19505.9/67366: 29% mana arcane_charge, clearcasting, rune_of_power, temporal_warp
5:35.863 aoe q arcane_explosion Fluffy_Pillow 20854.6/67366: 31% mana arcane_charge(2), rune_of_power, temporal_warp
5:36.863 aoe q arcane_explosion Fluffy_Pillow 17201.9/67366: 26% mana arcane_charge(3), clearcasting, rune_of_power, temporal_warp
5:37.863 aoe r arcane_barrage Fluffy_Pillow 18549.2/67366: 28% mana arcane_charge(4), temporal_warp
5:38.864 aoe q arcane_explosion Fluffy_Pillow 22592.5/67366: 34% mana temporal_warp
5:39.865 aoe q arcane_explosion Fluffy_Pillow 18941.1/67366: 28% mana arcane_charge, temporal_warp
5:40.867 aoe q arcane_explosion Fluffy_Pillow 15291.2/67366: 23% mana arcane_charge(2), temporal_warp
5:41.868 aoe q arcane_explosion Fluffy_Pillow 11639.8/67366: 17% mana arcane_charge(3)
5:43.168 aoe r arcane_barrage Fluffy_Pillow 8391.3/67366: 12% mana arcane_charge(4)
5:44.467 aoe q arcane_explosion Fluffy_Pillow 12836.1/67366: 19% mana
5:45.768 aoe q arcane_explosion Fluffy_Pillow 9589.0/67366: 14% mana arcane_charge
5:47.067 aoe q arcane_explosion Fluffy_Pillow 6339.1/67366: 9% mana arcane_charge(2), clearcasting
5:48.367 aoe q arcane_explosion Fluffy_Pillow 8090.6/67366: 12% mana arcane_charge(3)
5:49.668 aoe r arcane_barrage Fluffy_Pillow 4843.5/67366: 7% mana arcane_charge(4)

Stats

Level Bonus (60) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 198 1 199 199 0
Agility 306 2 308 308 0
Stamina 414 0 2013 1918 1504
Intellect 450 -3 1767 1588 1066 (46)
Spirit 0 0 0 0 0
Health 40260 38360 0
Mana 67366 67366 0
Spell Power 1767 1588 0
Crit 15.74% 15.74% 376
Haste 15.76% 15.76% 520
Versatility 7.97% 7.97% 319
Mana Regen 1347 1347 0
Mastery 34.73% 34.73% 733
Armor 369 369 369
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 227.00
Local Head Confidant's Favored Cap
ilevel: 226, stats: { 44 Armor, +82 Int, +149 Sta, +44 Haste, +98 Mastery }
Local Neck Noble's Birthstone Pendant
ilevel: 226, stats: { +84 Sta, +52 Crit, +162 Mastery }
Local Shoulders Shawl of the Penitent
ilevel: 233, stats: { 42 Armor, +65 Int, +122 Sta, +33 Crit, +76 Haste }
Local Chest Robes of the Cursed Commando
ilevel: 233, stats: { 61 Armor, +87 Int, +162 Sta, +47 Crit, +100 Haste }, enchant: { +20 Int }
Local Waist Cinch of Infinite Tightness
ilevel: 226, stats: { 33 Armor, +61 Int, +112 Sta, +69 Crit, +36 Vers }
Local Legs Courtier's Costume Trousers
ilevel: 226, stats: { 51 Armor, +82 Int, +149 Sta, +49 Vers, +93 Mastery }
Local Feet Slippers of the Forgotten Heretic
ilevel: 226, stats: { 36 Armor, +61 Int, +112 Sta, +73 Crit, +32 Mastery }
Local Wrists Acolyte's Velvet Bindings
ilevel: 226, stats: { 29 Armor, +46 Int, +84 Sta, +26 Vers, +53 Mastery }, enchant: { +15 Int }
Local Hands Impossibly Oversized Mitts
ilevel: 226, stats: { 33 Armor, +61 Int, +112 Sta, +31 Haste, +74 Mastery }
Local Finger1 Most Regal Signet of Sire Denathrius
ilevel: 233, stats: { +91 Sta, +178 Haste, +48 Mastery }, enchant: { +16 Mastery }
item effects: { equip: Denathrius' Privilege }
Local Finger2 Shadowghast Ring
ilevel: 235, stats: { +94 Sta, +115 Mastery, +115 Vers }, enchant: { +16 Mastery }
item effects: { equip: Temporal Warp }
Local Trinket1 Cabalist's Hymnal
ilevel: 226, stats: { +77 Int }
item effects: { equip: Crimson Chorus }
Local Trinket2 Sinful Aspirant's Badge of Ferocity
ilevel: 207, stats: { +91 Haste }
item effects: { use: Gladiator's Badge }
Local Back Mantle of Manifest Sins
ilevel: 226, stats: { 40 Armor, +84 Sta, +53 Crit, +26 Mastery, +46 StrAgiInt }
Local Main Hand Staff of the Penitent
ilevel: 226, weapon: { 93 - 128, 3.6 }, stats: { +82 Int, +281 Int, +149 Sta, +49 Crit, +93 Vers }, enchant: sinful_revelation

Profile

mage="Kyrian_Pelagos"
source=default
spec=arcane
level=60
race=troll
role=spell
position=back
talents=1031021
talent_override=resonance,if=3>2
covenant=kyrian
soulbind=328266//arcane_prodigy:6//51:6

# Default consumables
potion=deathly_fixation
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=variable,name=prepull_evo,op=reset,default=0
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
actions.precombat+=/variable,name=have_opened,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
actions.precombat+=/variable,name=final_burn,op=set,value=0
actions.precombat+=/variable,name=rs_max_delay,op=reset,default=5
actions.precombat+=/variable,name=ap_max_delay,op=reset,default=10
actions.precombat+=/variable,name=rop_max_delay,op=reset,default=20
actions.precombat+=/variable,name=totm_max_delay,op=reset,default=5
actions.precombat+=/variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
actions.precombat+=/variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
actions.precombat+=/variable,name=barrage_mana_pct,op=reset,default=70
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=reset,default=30
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
actions.precombat+=/variable,name=totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=aoe_totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=am_spam,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
actions.precombat+=/variable,name=am_spam_evo_pct,op=reset,default=15
actions.precombat+=/flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_familiar
actions.precombat+=/arcane_intellect
actions.precombat+=/conjure_mana_gem
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/frostbolt,if=variable.prepull_evo<=0
actions.precombat+=/evocation,if=variable.prepull_evo>0

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/call_action_list,name=shared_cds
actions+=/call_action_list,name=essences
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/call_action_list,name=opener,if=variable.have_opened<=0
actions+=/call_action_list,name=am_spam,if=variable.am_spam=1
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=rotation,if=variable.final_burn=0
actions+=/call_action_list,name=final_burn,if=variable.final_burn=1
actions+=/call_action_list,name=movement

actions.am_spam=cancel_action,if=action.evocation.channeling&mana.pct>=95
actions.am_spam+=/evocation,if=mana.pct<=variable.am_spam_evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/rune_of_power,if=buff.rune_of_power.down&cooldown.arcane_power.remains>0
actions.am_spam+=/touch_of_the_magi,if=(cooldown.arcane_power.remains=0&buff.rune_of_power.down)|prev_gcd.1.rune_of_power
actions.am_spam+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&buff.rune_of_power.down&essence.vision_of_perfection.enabled
actions.am_spam+=/arcane_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.ap_max_delay
actions.am_spam+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=action.arcane_missiles.execute_time&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_barrage,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_missiles,if=buff.clearcasting.react,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/arcane_missiles,if=!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.am_spam+=/arcane_barrage
actions.am_spam+=/arcane_blast

actions.aoe=frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
actions.aoe+=/arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
actions.aoe+=/mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
actions.aoe+=/arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
actions.aoe+=/rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
actions.aoe+=/presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
actions.aoe+=/arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
actions.aoe+=/supernova
actions.aoe+=/arcane_orb,if=buff.arcane_charge.stack=0
actions.aoe+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
actions.aoe+=/arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1

# Prioritize using grisly icicle with ap. Use it with totm otherwise.
actions.cooldowns=frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.cooldowns+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
# Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
# Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
actions.cooldowns+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
# Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
# Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
# Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
actions.cooldowns+=/arcane_power,if=(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
actions.cooldowns+=/rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
# Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
actions.cooldowns+=/presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
# Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.cooldowns+=/presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled

actions.essences=blood_of_the_enemy,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/blood_of_the_enemy,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains>=50&cooldown.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay
actions.essences+=/worldvein_resonance,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/guardian_of_azeroth,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/guardian_of_azeroth,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/concentrated_flame,line_cd=6,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/reaping_flames,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/focused_azerite_beam,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/purifying_blast,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/ripple_in_space,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/the_unbound_force,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/memory_of_lucid_dreams,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down

actions.final_burn=arcane_missiles,if=buff.clearcasting.react,chain=1
actions.final_burn+=/arcane_blast
actions.final_burn+=/arcane_barrage

actions.movement=blink_any,if=movement.distance>=10
actions.movement+=/presence_of_mind
actions.movement+=/arcane_missiles,if=movement.distance<10
actions.movement+=/arcane_orb
actions.movement+=/fire_blast

actions.opener=variable,name=have_opened,op=set,value=1,if=prev_gcd.1.evocation
actions.opener+=/fire_blast,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command_frost.up
actions.opener+=/frost_nova,if=runeforge.grisly_icicle.equipped&mana.pct>95
actions.opener+=/mirrors_of_torment
actions.opener+=/deathborne
actions.opener+=/radiant_spark,if=mana.pct>40
actions.opener+=/cancel_action,if=action.shifting_power.channeling&gcd.remains=0
actions.opener+=/shifting_power,if=soulbind.field_of_blossoms.enabled
actions.opener+=/touch_of_the_magi
actions.opener+=/arcane_power
actions.opener+=/rune_of_power,if=buff.rune_of_power.down
actions.opener+=/presence_of_mind
actions.opener+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.opener+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.opener+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.opener+=/arcane_missiles,if=buff.clearcasting.react,chain=1
actions.opener+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges&(cooldown.arcane_power.remains>10|active_enemies<=2)
actions.opener+=/arcane_blast,if=buff.rune_of_power.up|mana.pct>15
actions.opener+=/evocation,if=buff.rune_of_power.down,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.opener+=/arcane_barrage

actions.rotation=variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
actions.rotation+=/strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
actions.rotation+=/arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
actions.rotation+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.rotation+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.rotation+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
actions.rotation+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
actions.rotation+=/supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.rotation+=/arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
actions.rotation+=/arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_blast
actions.rotation+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.rotation+=/arcane_barrage

actions.shared_cds=use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
actions.shared_cds+=/use_items,if=buff.arcane_power.up
actions.shared_cds+=/potion,if=buff.arcane_power.up
actions.shared_cds+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
actions.shared_cds+=/lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/berserking,if=buff.arcane_power.up
actions.shared_cds+=/blood_fury,if=buff.arcane_power.up
actions.shared_cds+=/fireblood,if=buff.arcane_power.up
actions.shared_cds+=/ancestral_call,if=buff.arcane_power.up

head=confidants_favored_cap,id=183021,bonus_id=1498,ilevel=226
neck=nobles_birthstone_pendant,id=183039,bonus_id=1498,ilevel=226
shoulders=shawl_of_the_penitent,id=183020,bonus_id=1498,ilevel=233
back=mantle_of_manifest_sins,id=183033,bonus_id=1498,ilevel=226
chest=robes_of_the_cursed_commando,id=182998,bonus_id=1498,ilevel=233,enchant=eternal_insight
wrists=acolytes_velvet_bindings,id=183017,bonus_id=1498,ilevel=226,enchant=eternal_intellect
hands=impossibly_oversized_mitts,id=183022,bonus_id=1498,ilevel=226
waist=cinch_of_infinite_tightness,id=183028,bonus_id=1498,ilevel=226
legs=courtiers_costume_trousers,id=183011,bonus_id=1498,ilevel=226
feet=slippers_of_the_forgotten_heretic,id=182979,bonus_id=1498,ilevel=226
finger1=most_regal_signet_of_sire_denathrius,id=183036,bonus_id=1498,ilevel=233,enchant=16mastery
finger2=shadowghast_ring,id=178926,bonus_id=6648/6650/6758/6834/1532,ilevel=235,enchant=16mastery
trinket1=cabalists_hymnal,id=184028,bonus_id=1498,ilevel=226
trinket2=sinful_aspirants_badge_of_ferocity,id=175884,bonus_id=1521,ilevel=207
main_hand=staff_of_the_penitent,id=180000,bonus_id=7187/6652/1524,ilevel=226,enchant=sinful_revelation

# Gear Summary
# gear_ilvl=226.73
# gear_stamina=1504
# gear_intellect=1066
# gear_crit_rating=376
# gear_haste_rating=520
# gear_mastery_rating=733
# gear_versatility_rating=319
# gear_armor=369

Necrolord_Emeni : 9807 dps, 4309 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
9807.3 9807.3 18.8 / 0.191% 1313.0 / 13.4% 4.2
RPS Out RPS In Primary Resource Waiting APM Active Skill
2338.0 2212.3 Mana 0.00% 53.2 100.0% 100%
Talents
Necrolord
Runeforge

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Necrolord_Emeni 9807
Arcane Barrage 2487 25.4% 52.0 5.42sec 14339 11738 Direct 155.7 4031 8197 4787 18.1%

Stats Details: Arcane Barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 51.99 155.75 0.00 0.00 1.2216 0.0000 745546.43 745546.43 0.00% 11737.56 11737.56
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.85% 127.48 93 169 4030.51 1052 18408 4031.83 3645 4505 513740 513740 0.00%
crit 18.15% 28.27 11 48 8196.57 2103 36816 8197.55 5820 10990 231806 231806 0.00%

Action Details: Arcane Barrage

  • id:44425
  • school:arcane
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.728000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=0 + 72.8%} Arcane damage. For each Arcane Charge, deals {$36032s2=30}% additional damage$?a321526[, grants you {$321526s1=2}% of your maximum mana,][]$?a231564[ and hits {$36032s3=0} additional nearby $Ltarget:targets; for {$s2=40}% of its damage][]. |cFFFFFFFFConsumes all Arcane Charges.|r

Action Priority List

    aoe
    [r]:51.66
  • if_expr:buff.arcane_charge.stack=buff.arcane_charge.max_stack
    rotation
    [u]:0.01
  • if_expr:cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
    rotation
    [y]:0.30
Arcane Blast 3057 31.2% 34.2 7.17sec 26852 28592 Direct 99.0 7698 15358 9262 20.4%

Stats Details: Arcane Blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 34.16 99.02 0.00 0.00 0.9392 0.0000 917195.05 917195.05 0.00% 28591.76 28591.76
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.57% 78.78 44 98 7697.68 669 12810 7704.81 6764 8458 606474 606474 0.00%
crit 20.43% 20.23 6 36 15357.84 1337 25620 15380.34 11049 20255 310721 310721 0.00%

Action Details: Arcane Blast

  • id:30451
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1375.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.457000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:30451
  • name:Arcane Blast
  • school:arcane
  • tooltip:
  • description:Blasts the target with energy, dealing {$30451s1=0 + 45.7%} Arcane damage. Each Arcane Charge increases damage by {$36032s1=60}% and mana cost by {$36032s5=100}%, and reduces cast time by {$36032s4=8}%. |cFFFFFFFFGenerates 1 Arcane Charge.|r

Action Priority List

    aoe
    [o]:34.17
  • if_expr:buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
    rotation
    [v]:0.00
  • if_expr:buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
    rotation
    [x]:0.15
Arcane Explosion 2806 28.6% 136.8 2.02sec 6145 5045 Direct 410.4 1724 3494 2048 18.3%

Stats Details: Arcane Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 136.81 410.42 0.00 0.00 1.2180 0.0000 840675.17 840675.17 0.00% 5045.19 5045.19
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.68% 335.24 259 428 1724.32 1427 3855 1725.75 1662 1788 578060 578060 0.00%
crit 18.32% 75.18 48 110 3494.05 2855 7710 3496.52 3157 4015 262615 262615 0.00%

Action Details: Arcane Explosion

  • id:1449
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.502320
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s2=0 + 50.2%} Arcane damage to all enemies within $A2 yards.$?a137021[ |cFFFFFFFFGenerates {$s1=1} Arcane Charge if any targets are hit.|r][]

Action Priority List

    aoe
    [q]:136.76
  • if_expr:buff.arcane_charge.stack<buff.arcane_charge.max_stack
Arcane Orb 0 (505) 0.0% (5.2%) 11.6 24.65sec 13073 10536

Stats Details: Arcane Orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.59 0.00 0.00 0.00 1.2409 0.0000 0.00 0.00 0.00% 10535.68 10535.68

Action Details: Arcane Orb

  • id:153626
  • school:arcane
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:153626
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r

Action Priority List

    aoe
    [p]:11.55
  • if_expr:buff.arcane_charge.stack=0
    rotation
    [w]:0.04
  • if_expr:buff.arcane_charge.stack<=variable.totm_max_charges
    Arcane Orb (_bolt) 505 5.2% 34.7 24.65sec 4368 0 Direct 34.7 3666 7550 4366 18.1%

Stats Details: Arcane Orb Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 34.70 34.70 0.00 0.00 0.0000 0.0000 151566.27 151566.27 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.92% 28.43 17 40 3665.73 2821 7619 3666.10 3058 4068 104223 104223 0.00%
crit 18.08% 6.27 0 15 7549.52 5642 15237 7554.98 0 10268 47343 47343 0.00%

Action Details: Arcane Orb Bolt

  • id:153640
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.092000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:153640
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:{$@spelldesc153626=Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r}
Deathly Fixation 0 (82) 0.0% (0.8%) 17.5 1.42sec 1378 0

Stats Details: Deathly Fixation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.53 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Deathly Fixation

  • id:322253
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:42.90
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322253
  • name:Deathly Fixation
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1.
  • description:Deal {$s1=43} Shadow damage every $t1. Stacks up to 5 times.
    Deathly Eruption 82 0.8% 17.5 1.42sec 1378 0 Direct 17.5 1136 2271 1378 21.4%

Stats Details: Deathly Eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.53 17.53 0.00 0.00 0.0000 0.0000 24157.01 24157.01 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.64% 13.79 6 22 1135.74 1117 1184 1135.57 1117 1180 15656 15656 0.00%
crit 21.36% 3.74 0 10 2270.52 2233 2367 2224.28 0 2367 8501 8501 0.00%

Action Details: Deathly Eruption

  • id:322256
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:984.99
  • base_dd_max:984.99
  • base_dd_mult:1.00

Spelldata

  • id:322256
  • name:Deathly Eruption
  • school:shadow
  • tooltip:
  • description:Deal {$s1=985} Shadow damage.
Eternal Insight 39 0.4% 21.0 13.71sec 552 0 Direct 21.0 464 928 552 19.0%

Stats Details: Eternal Insight

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 21.01 21.01 0.00 0.00 0.0000 0.0000 11603.24 11603.24 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.04% 17.02 5 31 464.35 453 481 464.31 453 475 7905 7905 0.00%
crit 18.96% 3.98 0 10 928.42 907 961 912.48 0 961 3698 3698 0.00%

Action Details: Eternal Insight

  • id:342314
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:400.00
  • base_dd_max:400.00
  • base_dd_mult:1.00

Spelldata

  • id:342314
  • name:Eternal Insight
  • school:shadow
  • tooltip:
  • description:Deals {$s1=400} Shadow damage.
Frostbolt 4 0.0% 0.0 0.00sec 0 0 Direct 1.0 1024 2047 1178 15.0%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 1.00 0.00 0.00 0.0000 0.0000 1177.36 1177.36 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.99% 0.85 0 1 1023.69 1024 1024 870.02 0 1024 870 870 0.00%
crit 15.01% 0.15 0 1 2047.39 2047 2047 307.34 0 2047 307 307 0.00%

Action Details: Frostbolt

  • id:116
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.511000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116
  • name:Frostbolt
  • school:frost
  • tooltip:
  • description:Launches a bolt of frost at the enemy, causing {$228597s1=0} Frost damage and slowing movement speed by {$205708s1=50}% for {$205708d=8 seconds}.
Mirror Image 0 (22) 0.0% (0.2%) 1.0 0.00sec 6439 0

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.
    Frostbolt (mirror_image) 161  / 22 0.2% 117.0 0.99sec 55 55 Direct 117.0 46 93 55 19.9%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 117.00 117.00 0.00 0.00 1.0091 0.0000 6439.12 6439.12 0.00% 54.54 54.54
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.13% 93.75 78 105 45.73 30 58 45.73 44 48 4287 4287 0.00%
crit 19.87% 23.25 12 39 92.59 59 116 92.56 78 106 2152 2152 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:40.00
Touch of the Magi 0 (806) 0.0% (8.2%) 6.2 51.57sec 38947 32521

Stats Details: Touch Of The Magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.21 0.00 0.00 0.00 1.1977 0.0000 0.00 0.00 0.00% 32520.89 32520.89

Action Details: Touch Of The Magi

  • id:321507
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:4.0

Spelldata

  • id:321507
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]

Action Priority List

    aoe
    [k]:6.23
  • if_expr:buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
    Touch of the Magi (_explosion) 806 8.2% 6.2 51.45sec 38947 0 Direct 18.6 13034 0 13034 0.0%

Stats Details: Touch Of The Magi Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.21 18.57 0.00 0.00 0.0000 0.0000 241922.89 241922.89 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 18.57 15 21 13034.06 1480 73960 12999.96 8838 16627 241923 241923 0.00%

Action Details: Touch Of The Magi Explosion

  • id:210833
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:9188.53
  • base_dd_max:9188.53
  • base_dd_mult:1.00

Spelldata

  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc321507=Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]}
Simple Action Stats Execute Interval
Necrolord_Emeni
Arcane Power 2.9 127.07sec

Stats Details: Arcane Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.86 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Power

  • id:12042
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].

Action Priority List

    aoe
    [l]:2.87
  • if_expr:((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
Berserking 1.9 254.36sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.86 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    shared_cds
    [~]:1.87
  • if_expr:buff.arcane_power.up
Conjure Mana Gem 1.0 0.00sec

Stats Details: Conjure Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Conjure Mana Gem

  • id:759
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:9000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:759
  • name:Conjure Mana Gem
  • school:arcane
  • tooltip:
  • description:Conjures a Mana Gem that can be used to instantly restore {$5405s1=10}% mana, and holds up to {$s2=3} charges. $@spellname118812 {$@spelldesc118812=Conjured items disappear if logged out for more than 15 minutes.}
Deathborne 1.9 253.82sec

Stats Details: Deathborne

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.88 0.00 0.00 0.00 1.2995 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Deathborne

  • id:324220
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:324220
  • name:Deathborne
  • school:shadow
  • tooltip:Transformed into a powerful skeletal mage, greatly enhancing your Frostbolt, Fireball, and Arcane Blast and increasing your spell damage by {$s2=10}%.
  • description:Transform into a powerful skeletal mage for {$d=20 seconds}. While in the form of a skeletal mage, your Frostbolt, Fireball, and Arcane Blast hit up to {$s4=2} enemies near your target and your spell damage is increased by {$s2=10}%.

Action Priority List

    aoe
    [j]:1.89
  • if_expr:cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
Evocation 2.0 184.99sec

Stats Details: Evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.97 0.00 11.70 0.00 3.2902 0.5512 0.00 0.00 0.00% 0.00 0.00

Action Details: Evocation

  • id:12051
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Necrolord_Emeni
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.

Action Priority List

    aoe
    [s]:1.97
  • interrupt_if_expr:mana.pct>=85
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Necrolord_Emeni
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Necrolord_Emeni
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Deathly Fixation (potion) 1.0 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307497
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    shared_cds
    [|]:1.00
  • if_expr:buff.arcane_power.up
Presence of Mind 1.8 247.87sec

Stats Details: Presence Of Mind

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.85 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Presence Of Mind

  • id:205025
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:60.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:205025
  • name:Presence of Mind
  • school:arcane
  • tooltip:Arcane Blast is instant cast.
  • description:Causes your next $n Arcane Blasts to be instant cast.

Action Priority List

    aoe
    [n]:1.80
  • if_expr:buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
    cooldowns
    [t]:0.05
  • if_expr:debuff.touch_of_the_magi.up&!covenant.kyrian.enabled
Rune of Power 6.1 50.55sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.08 0.00 0.00 0.00 1.1959 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    aoe
    [m]:6.10
  • if_expr:buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Time Warp 1.5 300.40sec

Stats Details: Time Warp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.49 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Time Warp

  • id:80353
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:2000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:80353
  • name:Time Warp
  • school:arcane
  • tooltip:Haste increased by $w1%. $?$W4>0[Time rate increased by $w4%.][]$?$W3=1[ When the effect ends, you die.][]
  • description:Warp the flow of time, increasing haste by {$s1=30}% $?a320919[and time rate by {$s4=0}% ][]for all party and raid members for {$d=40 seconds}. Allies will be unable to benefit from Bloodlust, Heroism, or Time Warp again for {$57724d=600 seconds}.$?a320920[ When the effect ends, you die.][]

Action Priority List

    shared_cds
    [}]:1.48
  • if_expr:runeforge.temporal_warp.equipped&buff.exhaustion.up
Replenish Mana (use_mana_gem) 2.9 121.84sec

Stats Details: Use Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.95 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Use Mana Gem

  • id:5405
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Necrolord_Emeni
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5405
  • name:Replenish Mana
  • school:physical
  • tooltip:Restoring $w2 mana every $t1 sec.
  • description:Restores {$s1=10}% mana.

Action Priority List

    shared_cds
    [z]:2.95
  • if_expr:(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Arcane Charge 52.8 170.7 5.7sec 1.3sec 4.3sec 75.26% 0.00% 32.4 (32.5) 0.0

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.5s / 30.6s
  • trigger_min/max:0.0s / 8.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 29.3s

Stack Uptimes

  • arcane_charge_1:16.70%
  • arcane_charge_2:14.93%
  • arcane_charge_3:14.95%
  • arcane_charge_4:28.68%

Spelldata

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 2.9 0.0 127.0sec 127.0sec 14.7sec 14.06% 0.00% 0.0 (0.0) 2.7

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:121.8s / 135.6s
  • trigger_min/max:121.8s / 135.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • arcane_power_1:14.06%

Spelldata

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Berserking 1.9 0.0 254.3sec 254.3sec 11.7sec 7.24% 22.26% 0.0 (0.0) 1.8

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:251.3s / 258.8s
  • trigger_min/max:251.3s / 258.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • berserking_1:7.24%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.51% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.51%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Clearcasting 23.7 4.1 12.5sec 10.6sec 3.0sec 23.43% 0.00% 1.4 (1.4) 0.3

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_clearcasting
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • clearcasting_1:17.49%
  • clearcasting_2:2.85%
  • clearcasting_3:3.09%

Spelldata

  • id:263725
  • name:Clearcasting
  • tooltip:Your next Arcane Missiles or Arcane Explosion costs no mana{$?s321758=false}[ and Arcane Missiles fires an additional missile][].
  • description:{$@spelldesc79684=For each ${$c*100/{$s1=200}} mana you spend, you have a 1% chance to gain Clearcasting, making your next Arcane Missiles or Arcane Explosion free and channel {$277726s1=20}% faster.$?a321758[ Arcane Missiles fires {$321758s2=1} additional missile.][]}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Crimson Chorus 5.4 0.0 60.8sec 60.8sec 28.6sec 51.87% 0.00% 0.0 (0.0) 4.9

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_crimson_chorus
  • max_stacks:3
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:60.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:10.00
  • associated item:Cabalist's Hymnal

Stat Details

  • stat:crit_rating
  • amount:95.00

Trigger Details

  • interval_min/max:60.0s / 65.4s
  • trigger_min/max:60.0s / 65.4s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 30.0s

Stack Uptimes

  • crimson_chorus_1:17.88%
  • crimson_chorus_2:17.28%
  • crimson_chorus_3:16.71%

Spelldata

  • id:344803
  • name:Crimson Chorus
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc344806=Join the Crimson Chorus. Every minute, your Critical Strike swells by ${{$s1=44}*3} over ${{$344803d=10 seconds}*3} sec. before returning to normal. This effect is increased by {$s2=5}% for each member of the Crimson Chorus in your party.}
  • max_stacks:3
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Deathborne 1.9 0.0 253.8sec 253.8sec 19.2sec 11.91% 0.00% 0.0 (0.0) 1.7

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_deathborne
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:250.8s / 258.2s
  • trigger_min/max:250.8s / 258.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • deathborne_1:11.91%

Spelldata

  • id:324220
  • name:Deathborne
  • tooltip:Transformed into a powerful skeletal mage, greatly enhancing your Frostbolt, Fireball, and Arcane Blast and increasing your spell damage by {$s2=10}%.
  • description:Transform into a powerful skeletal mage for {$d=20 seconds}. While in the form of a skeletal mage, your Frostbolt, Fireball, and Arcane Blast hit up to {$s4=2} enemies near your target and your spell damage is increased by {$s2=10}%.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Evocation 2.0 0.0 184.4sec 184.4sec 3.3sec 2.13% 0.00% 7.8 (7.8) 0.0

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_evocation
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:7.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:1.00

Trigger Details

  • interval_min/max:90.0s / 296.7s
  • trigger_min/max:90.0s / 296.7s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 4.3s

Stack Uptimes

  • evocation_1:2.13%

Spelldata

  • id:12051
  • name:Evocation
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Gladiator's Badge 2.9 0.0 127.0sec 127.0sec 14.7sec 14.06% 0.00% 0.0 (0.0) 2.7

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_gladiators_badge
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Sinful Aspirant's Badge of Ferocity

Stat Details

  • stat:intellect
  • amount:342.00

Trigger Details

  • interval_min/max:121.8s / 135.6s
  • trigger_min/max:121.8s / 135.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • gladiators_badge_1:14.06%

Spelldata

  • id:345228
  • name:Gladiator's Badge
  • tooltip:Primary stat increased by $w1.
  • description:Increases primary stat by {$s1=252} for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:0.00%
Lead by Example 1.9 0.0 253.8sec 253.8sec 28.1sec 17.39% 0.00% 0.0 (0.0) 1.6

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_lead_by_example
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:250.8s / 258.2s
  • trigger_min/max:250.8s / 258.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • lead_by_example_1:17.39%

Spelldata

  • id:342181
  • name:Lead by Example
  • tooltip:$pri increased by $w1%.
  • description:{$@spelldesc342156=$?a137005[Abomination Limb]?a212611[Fodder to the Flame]?a137009[Adaptive Swarm]?a137014[Death Chakram]?a137018[Deathborne]?a137022[Bonedust Brew]?a137026[Vanquisher's Hammer]?a137030[Unholy Nova]?a137034[Serrated Bone Spike]?a137038[Primordial Wave]?a137042[Decimating Bolt]?a137047[Conqueror's Banner][Activating your Necrolord class ability] increases your $pri by {$342181s2=5}% and nearby allies' primary stat by {$342181s1=2}% for ${{$s3=10}*$<mod>}.1 sec. You gain {$342181s2=5}% additional $pri for each ally affected, up to ${({$342181s3=3}*{$342181s2=5})}%.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deathly Fixation 1.0 0.0 0.0sec 0.0sec 25.0sec 8.45% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_potion_of_deathly_fixation
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:25.0s / 25.0s

Stack Uptimes

  • potion_of_deathly_fixation_1:8.45%

Spelldata

  • id:307497
  • name:Potion of Deathly Fixation
  • tooltip:Chance to apply Deathly Fixation to your target.
  • description:Your damaging spells and abilities have a chance to apply Deathly Fixation to your target, dealing {$322253s1=43} Shadow damage over {$322253d=8 seconds} and stacking up to 5 times. Upon reaching 5 stacks, Deathly Fixation explodes, dealing {$322256s1=985} Shadow damage to the target. If you consume this potion while your weapon is augmented with Shadowcore Oil, the explosion damage is increased by {$s2=10}%. Lasts {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Presence of Mind 1.8 0.0 244.6sec 244.6sec 5.1sec 3.17% 15.88% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_presence_of_mind
  • max_stacks:3
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:62.4s / 257.6s
  • trigger_min/max:62.4s / 257.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 145.8s

Stack Uptimes

  • presence_of_mind_1:0.58%
  • presence_of_mind_2:0.60%
  • presence_of_mind_3:1.99%

Spelldata

  • id:205025
  • name:Presence of Mind
  • tooltip:Arcane Blast is instant cast.
  • description:Causes your next $n Arcane Blasts to be instant cast.
  • max_stacks:0
  • duration:-0.00
  • cooldown:60.00
  • default_chance:100.00%
Rune of Power 8.9 0.0 34.6sec 34.6sec 11.8sec 35.17% 0.00% 0.0 (0.0) 8.6

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.8s / 52.4s
  • trigger_min/max:12.8s / 52.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • rune_of_power_1:35.17%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Temporal Warp 1.5 0.0 300.4sec 300.4sec 35.3sec 17.23% 0.00% 0.0 (0.0) 1.1

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_temporal_warp
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:300.0s / 303.7s
  • trigger_min/max:300.0s / 303.7s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 40.0s

Stack Uptimes

  • temporal_warp_1:17.23%

Spelldata

  • id:327355
  • name:Temporal Warp
  • tooltip:Haste increased by $w1%.
  • description:{$@spelldesc327351=While you have Temporal Displacement or other similar effects, you may use Time Warp to grant yourself {$327355s1=30}% Haste for {$327355d=40 seconds}.}
  • max_stacks:0
  • duration:40.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism)

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Benefit Avg % Min Max
Arcane Barrage Arcane Charge 1 0.06% 0.00% 4.69%
Arcane Barrage Arcane Charge 2 0.21% 0.00% 8.16%
Arcane Barrage Arcane Charge 3 0.32% 0.00% 7.27%
Arcane Barrage Arcane Charge 4 99.41% 87.23% 100.00%
Arcane Blast Arcane Charge 0 4.37% 2.44% 11.11%
Arcane Blast Arcane Charge 1 1.00% 0.00% 10.81%
Arcane Blast Arcane Charge 2 0.83% 0.00% 7.14%
Arcane Blast Arcane Charge 3 0.68% 0.00% 5.71%
Arcane Blast Arcane Charge 4 93.12% 74.29% 97.37%
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 0.37% 0.14% 3.18% 0.6s 0.0s 4.7s
Conserve Phase 100.00% 100.00% 100.00% 299.9s 240.2s 360.0s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.0000.0000.000179.943120.203239.964
Evocation61.9560.000206.723157.87960.958238.287
Rune of Power5.8650.00923.12437.00819.38247.491
Touch of the Magi4.6900.01222.24930.54018.08357.350
Arcane Power5.3061.79315.60415.5183.91020.841
Arcane Barrage3.2990.00028.014173.814133.982210.350
Arcane Orb6.3780.00034.59475.84848.72493.318
Deathborne33.9030.00076.94971.73458.90877.893
Presence of Mind88.4100.000196.051197.03252.518236.091
Time Warp1.0040.0003.7221.4971.2965.023

Burn Phases

Burn phase duration tracks the amount of time spent in each burn phase. This is defined as the time between a start_burn_phase and stop_burn_phase action being executed. Note that "execute" burn phases, i.e., the final burn of a fight, is also included.

Burn Phase Duration
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Mana at burn start is the mana level recorded (in percentage of total mana) when a start_burn_phase command is executed.

Mana at Burn Start
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Necrolord_Emeni
mana_regen Mana 798.98 401544.45 60.52% 502.57 2008.09 0.50%
Evocation Mana 73.70 102842.32 15.50% 1395.43 0.00 0.00%
Mana Gem Mana 2.95 19866.58 2.99% 6736.57 0.00 0.00%
Arcane Barrage Mana 51.98 139192.98 20.98% 2677.91 533.61 0.38%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 66365.7 2212.33 2338.02 2540.9 29666.3 65.1 67137.9
Usage Type Count Total Avg RPE APR
Necrolord_Emeni
arcane_blast Mana 34.2 133848.3 3914.7 3918.6 6.9
arcane_explosion Mana 136.8 537625.5 3931.0 3929.8 1.6
arcane_orb Mana 11.6 5551.3 478.9 478.8 27.3
deathborne Mana 1.9 4696.6 2500.0 2502.0 0.0
time_warp Mana 1.5 2967.8 2000.0 1992.1 0.0
touch_of_the_magi Mana 6.2 15522.5 2500.0 2499.0 15.6

Statistics & Data Analysis

Fight Length
Necrolord_Emeni Fight Length
Count 1319
Mean 299.94
Minimum 240.20
Maximum 359.96
Spread ( max - min ) 119.76
Range [ ( max - min ) / 2 * 100% ] 19.96%
DPS
Necrolord_Emeni Damage Per Second
Count 1319
Mean 9807.33
Minimum 8859.53
Maximum 10911.01
Spread ( max - min ) 2051.49
Range [ ( max - min ) / 2 * 100% ] 10.46%
Standard Deviation 347.5154
5th Percentile 9262.07
95th Percentile 10415.41
( 95th Percentile - 5th Percentile ) 1153.34
Mean Distribution
Standard Deviation 9.5687
95.00% Confidence Interval ( 9788.58 - 9826.08 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 49
0.1% Error 4824
0.1 Scale Factor Error with Delta=300 1031
0.05 Scale Factor Error with Delta=300 4124
0.01 Scale Factor Error with Delta=300 103094
Priority Target DPS
Necrolord_Emeni Priority Target Damage Per Second
Count 1319
Mean 4309.43
Minimum 3750.52
Maximum 4898.75
Spread ( max - min ) 1148.23
Range [ ( max - min ) / 2 * 100% ] 13.32%
Standard Deviation 191.5090
5th Percentile 4004.55
95th Percentile 4625.27
( 95th Percentile - 5th Percentile ) 620.72
Mean Distribution
Standard Deviation 5.2731
95.00% Confidence Interval ( 4299.09 - 4319.76 )
Normalized 95.00% Confidence Interval ( 99.76% - 100.24% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 76
0.1% Error 7587
0.1 Scale Factor Error with Delta=300 314
0.05 Scale Factor Error with Delta=300 1253
0.01 Scale Factor Error with Delta=300 31309
DPS(e)
Necrolord_Emeni Damage Per Second (Effective)
Count 1319
Mean 9807.33
Minimum 8859.53
Maximum 10911.01
Spread ( max - min ) 2051.49
Range [ ( max - min ) / 2 * 100% ] 10.46%
Damage
Necrolord_Emeni Damage
Count 1319
Mean 2933843.43
Minimum 2185064.31
Maximum 3546842.17
Spread ( max - min ) 1361777.86
Range [ ( max - min ) / 2 * 100% ] 23.21%
DTPS
Necrolord_Emeni Damage Taken Per Second
Count 1319
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Necrolord_Emeni Healing Per Second
Count 1319
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Necrolord_Emeni Healing Per Second (Effective)
Count 1319
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Necrolord_Emeni Heal
Count 1319
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Necrolord_Emeni Healing Taken Per Second
Count 1319
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Necrolord_Emeni Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Necrolord_EmeniTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Necrolord_Emeni Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 variable,name=prepull_evo,op=reset,default=0
1 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
2 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
3 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
4 0.00 variable,name=have_opened,op=reset,default=0
5 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
6 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
7 0.00 variable,name=final_burn,op=set,value=0
8 0.00 variable,name=rs_max_delay,op=reset,default=5
9 0.00 variable,name=ap_max_delay,op=reset,default=10
A 0.00 variable,name=rop_max_delay,op=reset,default=20
B 0.00 variable,name=totm_max_delay,op=reset,default=5
C 0.00 variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
D 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
E 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
F 0.00 variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
G 0.00 variable,name=barrage_mana_pct,op=reset,default=70
H 0.00 variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
I 0.00 variable,name=ap_minimum_mana_pct,op=reset,default=30
J 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
K 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
L 0.00 variable,name=totm_max_charges,op=reset,default=2
M 0.00 variable,name=aoe_totm_max_charges,op=reset,default=2
N 0.00 variable,name=am_spam,op=reset,default=0
O 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
P 0.00 variable,name=am_spam_evo_pct,op=reset,default=15
Q 0.00 flask
R 0.00 food
S 0.00 augmentation
T 0.00 arcane_familiar
U 0.00 arcane_intellect
V 0.00 conjure_mana_gem
W 0.00 snapshot_stats
X 0.00 mirror_image
Y 0.00 frostbolt,if=variable.prepull_evo<=0
Z 0.00 evocation,if=variable.prepull_evo>0
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
a 0.00 call_action_list,name=shared_cds
b 0.00 call_action_list,name=essences
c 0.00 call_action_list,name=aoe,if=active_enemies>2
d 0.00 call_action_list,name=opener,if=variable.have_opened<=0
e 0.00 call_action_list,name=am_spam,if=variable.am_spam=1
f 0.00 call_action_list,name=cooldowns
g 0.00 call_action_list,name=rotation,if=variable.final_burn=0
h 0.00 call_action_list,name=final_burn,if=variable.final_burn=1
i 0.00 call_action_list,name=movement
actions.aoe
# count action,conditions
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
0.00 arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
0.00 mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
j 1.89 deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
k 6.23 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
l 2.87 arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
m 6.10 rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
n 1.80 presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
o 34.17 arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
0.00 supernova
p 11.55 arcane_orb,if=buff.arcane_charge.stack=0
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
q 136.76 arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
0.00 arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
r 51.66 arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
s 1.97 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.cooldowns
# count action,conditions
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
Prioritize using grisly icicle with ap. Use it with totm otherwise.
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
0.00 mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
0.00 mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
0.00 deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
0.00 deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
0.00 radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
0.00 touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
0.00 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
0.00 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
0.00 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
0.00 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
0.00 arcane_power,if=(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
0.00 rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
0.00 presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
t 0.05 presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled
Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.rotation
# count action,conditions
0.00 variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
0.00 arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
u 0.01 arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
0.00 arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
0.00 arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
0.00 strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
0.00 arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
0.00 arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
v 0.00 arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
0.00 arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
0.00 arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
0.00 arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
0.00 arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
0.00 arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
w 0.04 arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
0.00 supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
0.00 arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
0.00 arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
0.00 arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
0.00 arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
x 0.15 arcane_blast
0.00 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
y 0.30 arcane_barrage
actions.shared_cds
# count action,conditions
z 2.95 use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
{ 2.87 use_items,if=buff.arcane_power.up
| 1.00 potion,if=buff.arcane_power.up
} 1.48 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
0.00 lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
~ 1.87 berserking,if=buff.arcane_power.up
0.00 blood_fury,if=buff.arcane_power.up
0.00 fireblood,if=buff.arcane_power.up
0.00 ancestral_call,if=buff.arcane_power.up

Sample Sequence

045789ABGILMNPQRVXYj}kl{|~oozoooooonoooooooomooooooroqqqrprqqqqrqqsqqrqqqqrqqqqrprqqqqrqqqqrkmrqqqqrprqqqqrqqqqrqqqqrprqqqqrqqqqrkmrqqqtyprqqzqql{rqqqqrqqqqrprqqqqrqqqqrkmrqqqqrprqqqqrqqqsqrprqqqqrqqqqrqkmrprqqqqrqqqqrqqqqrprqqqqrqqqqzrqqqqrjkl{~ooooooooooomoooorprqqqqrqqqqrqqsqqr}prqqqqrqqqqrkmrqqqqrprqqqqrqqqqrqqqqrqqqqrprqqq

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 prepull_evo Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat 4 have_opened Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat 5 have_opened Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat 7 final_burn Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat 8 rs_max_delay Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat 9 ap_max_delay Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat A rop_max_delay Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat B totm_max_delay Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat G barrage_mana_pct Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat I ap_minimum_mana_pct Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat L totm_max_charges Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat M aoe_totm_max_charges Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat N am_spam Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat P am_spam_evo_pct Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat Q flask Necrolord_Emeni 67365.7/67366: 100% mana
Pre precombat R food Necrolord_Emeni 67365.7/67366: 100% mana
Pre precombat V conjure_mana_gem Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat X mirror_image Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat Y frostbolt Fluffy_Pillow 67365.7/67366: 100% mana
0:00.000 aoe j deathborne Fluffy_Pillow 66365.7/67366: 99% mana
0:01.298 shared_cds } time_warp Fluffy_Pillow 64869.8/67366: 96% mana bloodlust, deathborne, crimson_chorus, lead_by_example
0:01.298 aoe k touch_of_the_magi Fluffy_Pillow 62869.8/67366: 93% mana bloodlust, temporal_warp, deathborne, crimson_chorus, lead_by_example
0:02.069 aoe l arcane_power Fluffy_Pillow 61408.5/67366: 91% mana bloodlust, arcane_charge(4), temporal_warp, deathborne, crimson_chorus, lead_by_example
0:02.069 shared_cds { use_items Fluffy_Pillow 61408.5/67366: 91% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, deathborne, crimson_chorus, lead_by_example
0:02.069 shared_cds | potion Fluffy_Pillow 61408.5/67366: 91% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, deathborne, crimson_chorus, lead_by_example, gladiators_badge
0:02.069 shared_cds ~ berserking Fluffy_Pillow 61408.5/67366: 91% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, deathborne, crimson_chorus, lead_by_example, potion_of_deathly_fixation, gladiators_badge
0:02.069 aoe o arcane_blast Fluffy_Pillow 61408.5/67366: 91% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, deathborne, crimson_chorus, lead_by_example, potion_of_deathly_fixation, gladiators_badge
0:02.824 aoe o arcane_blast Fluffy_Pillow 58988.3/67366: 88% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, deathborne, crimson_chorus, lead_by_example, potion_of_deathly_fixation, gladiators_badge
0:03.578 shared_cds z use_mana_gem Necrolord_Emeni 56566.6/67366: 84% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, deathborne, crimson_chorus, lead_by_example, potion_of_deathly_fixation, gladiators_badge
0:03.578 aoe o arcane_blast Fluffy_Pillow 63303.2/67366: 94% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, deathborne, crimson_chorus, lead_by_example, potion_of_deathly_fixation, gladiators_badge
0:04.334 aoe o arcane_blast Fluffy_Pillow 60884.3/67366: 90% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, deathborne, crimson_chorus, lead_by_example, potion_of_deathly_fixation, gladiators_badge
0:05.088 aoe o arcane_blast Fluffy_Pillow 58462.6/67366: 87% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, deathborne, crimson_chorus, lead_by_example, potion_of_deathly_fixation, gladiators_badge
0:05.841 aoe o arcane_blast Fluffy_Pillow 56039.7/67366: 83% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, deathborne, crimson_chorus, lead_by_example, potion_of_deathly_fixation, gladiators_badge
0:06.596 aoe o arcane_blast Fluffy_Pillow 53619.4/67366: 80% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, deathborne, crimson_chorus, lead_by_example, potion_of_deathly_fixation, gladiators_badge
0:07.351 aoe o arcane_blast Fluffy_Pillow 51199.1/67366: 76% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, deathborne, crimson_chorus, lead_by_example, potion_of_deathly_fixation, gladiators_badge
0:08.105 aoe n presence_of_mind Fluffy_Pillow 48777.5/67366: 72% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, deathborne, crimson_chorus, lead_by_example, potion_of_deathly_fixation, gladiators_badge
0:08.105 aoe o arcane_blast Fluffy_Pillow 48777.5/67366: 72% mana bloodlust, berserking, arcane_charge(4), arcane_power, presence_of_mind(3), rune_of_power, temporal_warp, deathborne, crimson_chorus, lead_by_example, potion_of_deathly_fixation, gladiators_badge
0:08.859 aoe o arcane_blast Fluffy_Pillow 46355.9/67366: 69% mana bloodlust, berserking, arcane_charge(4), arcane_power, presence_of_mind(2), rune_of_power, temporal_warp, deathborne, crimson_chorus, lead_by_example, potion_of_deathly_fixation, gladiators_badge
0:09.614 aoe o arcane_blast Fluffy_Pillow 43935.6/67366: 65% mana bloodlust, berserking, arcane_charge(4), arcane_power, presence_of_mind, rune_of_power, temporal_warp, deathborne, crimson_chorus, lead_by_example, potion_of_deathly_fixation, gladiators_badge
0:10.369 aoe o arcane_blast Fluffy_Pillow 41515.3/67366: 62% mana bloodlust, berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, temporal_warp, deathborne, crimson_chorus(2), lead_by_example, potion_of_deathly_fixation, gladiators_badge
0:11.123 aoe o arcane_blast Fluffy_Pillow 39093.7/67366: 58% mana bloodlust, berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, temporal_warp, deathborne, crimson_chorus(2), lead_by_example, potion_of_deathly_fixation, gladiators_badge
0:11.879 aoe o arcane_blast Fluffy_Pillow 36674.8/67366: 54% mana bloodlust, berserking, arcane_charge(4), arcane_power, clearcasting(2), rune_of_power, temporal_warp, deathborne, crimson_chorus(2), lead_by_example, potion_of_deathly_fixation, gladiators_badge
0:12.634 aoe o arcane_blast Fluffy_Pillow 34254.5/67366: 51% mana bloodlust, berserking, arcane_charge(4), arcane_power, clearcasting(2), rune_of_power, temporal_warp, deathborne, crimson_chorus(2), lead_by_example, potion_of_deathly_fixation, gladiators_badge
0:13.389 aoe o arcane_blast Fluffy_Pillow 31834.2/67366: 47% mana bloodlust, berserking, arcane_charge(4), arcane_power, clearcasting(2), rune_of_power, temporal_warp, deathborne, crimson_chorus(2), lead_by_example, potion_of_deathly_fixation, gladiators_badge
0:14.142 aoe m rune_of_power Fluffy_Pillow 29411.2/67366: 44% mana bloodlust, arcane_charge(4), arcane_power, clearcasting(3), temporal_warp, deathborne, crimson_chorus(2), lead_by_example, potion_of_deathly_fixation, gladiators_badge
0:14.913 aoe o arcane_blast Fluffy_Pillow 30450.0/67366: 45% mana bloodlust, arcane_charge(4), arcane_power, clearcasting(3), rune_of_power, temporal_warp, deathborne, crimson_chorus(2), lead_by_example, potion_of_deathly_fixation, gladiators_badge
0:15.699 aoe o arcane_blast Fluffy_Pillow 28071.5/67366: 42% mana bloodlust, arcane_charge(4), arcane_power, clearcasting(3), rune_of_power, temporal_warp, deathborne, crimson_chorus(2), lead_by_example, potion_of_deathly_fixation, gladiators_badge
0:16.485 aoe o arcane_blast Fluffy_Pillow 25693.0/67366: 38% mana bloodlust, arcane_charge(4), arcane_power, clearcasting(3), rune_of_power, temporal_warp, deathborne, crimson_chorus(2), lead_by_example, potion_of_deathly_fixation, gladiators_badge
0:17.271 aoe o arcane_blast Fluffy_Pillow 19877.0/67366: 30% mana bloodlust, arcane_charge(4), clearcasting(3), rune_of_power, temporal_warp, deathborne, crimson_chorus(2), lead_by_example, potion_of_deathly_fixation
0:18.056 aoe o arcane_blast Fluffy_Pillow 14059.6/67366: 21% mana bloodlust, arcane_charge(4), clearcasting(3), rune_of_power, temporal_warp, deathborne, crimson_chorus(2), lead_by_example, potion_of_deathly_fixation
0:18.839 aoe o arcane_blast Fluffy_Pillow 8239.6/67366: 12% mana bloodlust, arcane_charge(4), clearcasting(3), rune_of_power, temporal_warp, deathborne, crimson_chorus(2), lead_by_example, potion_of_deathly_fixation
0:19.625 aoe r arcane_barrage Fluffy_Pillow 2423.6/67366: 4% mana bloodlust, arcane_charge(4), clearcasting(3), rune_of_power, temporal_warp, deathborne, crimson_chorus(2), lead_by_example, potion_of_deathly_fixation
0:20.395 aoe o arcane_blast Fluffy_Pillow 6155.6/67366: 9% mana bloodlust, clearcasting(3), rune_of_power, temporal_warp, deathborne, crimson_chorus(3), lead_by_example, potion_of_deathly_fixation
0:21.550 aoe q arcane_explosion Fluffy_Pillow 6336.8/67366: 9% mana bloodlust, arcane_charge, clearcasting(3), rune_of_power, temporal_warp, crimson_chorus(3), lead_by_example, potion_of_deathly_fixation
0:22.322 aoe q arcane_explosion Fluffy_Pillow 7376.9/67366: 11% mana bloodlust, arcane_charge(2), clearcasting(2), rune_of_power, temporal_warp, crimson_chorus(3), lead_by_example, potion_of_deathly_fixation
0:23.091 aoe q arcane_explosion Fluffy_Pillow 8413.0/67366: 12% mana bloodlust, arcane_charge(3), clearcasting, rune_of_power, temporal_warp, crimson_chorus(3), lead_by_example, potion_of_deathly_fixation
0:23.861 aoe r arcane_barrage Fluffy_Pillow 9450.4/67366: 14% mana bloodlust, arcane_charge(4), rune_of_power, temporal_warp, crimson_chorus(3), lead_by_example, potion_of_deathly_fixation
0:24.633 aoe p arcane_orb Fluffy_Pillow 13185.2/67366: 20% mana bloodlust, rune_of_power, temporal_warp, crimson_chorus(3), lead_by_example, potion_of_deathly_fixation
0:25.403 aoe r arcane_barrage Fluffy_Pillow 13722.6/67366: 20% mana bloodlust, arcane_charge(4), rune_of_power, temporal_warp, crimson_chorus(3), lead_by_example, potion_of_deathly_fixation
0:26.173 aoe q arcane_explosion Fluffy_Pillow 17454.7/67366: 26% mana bloodlust, rune_of_power, temporal_warp, crimson_chorus(3), lead_by_example, potion_of_deathly_fixation
0:26.944 aoe q arcane_explosion Fluffy_Pillow 13493.4/67366: 20% mana bloodlust, arcane_charge, clearcasting, temporal_warp, crimson_chorus(3), lead_by_example, potion_of_deathly_fixation
0:27.716 aoe q arcane_explosion Fluffy_Pillow 14533.6/67366: 22% mana bloodlust, arcane_charge(2), temporal_warp, crimson_chorus(3), lead_by_example
0:28.487 aoe q arcane_explosion Fluffy_Pillow 10572.3/67366: 16% mana bloodlust, arcane_charge(3), temporal_warp, crimson_chorus(3), lead_by_example
0:29.257 aoe r arcane_barrage Fluffy_Pillow 6609.8/67366: 10% mana bloodlust, arcane_charge(4), temporal_warp, crimson_chorus(3), lead_by_example
0:30.029 aoe q arcane_explosion Fluffy_Pillow 10344.5/67366: 15% mana bloodlust, temporal_warp, crimson_chorus(3), lead_by_example
0:30.802 aoe q arcane_explosion Fluffy_Pillow 6386.0/67366: 9% mana bloodlust, arcane_charge, temporal_warp, lead_by_example
0:31.574 aoe s evocation Necrolord_Emeni 2426.1/67366: 4% mana bloodlust, arcane_charge(2), temporal_warp
0:34.133 aoe q arcane_explosion Fluffy_Pillow 59673.5/67366: 89% mana bloodlust, arcane_charge(2), temporal_warp
0:34.902 aoe q arcane_explosion Fluffy_Pillow 55709.6/67366: 83% mana bloodlust, arcane_charge(3), temporal_warp
0:35.671 aoe r arcane_barrage Fluffy_Pillow 51745.7/67366: 77% mana bloodlust, arcane_charge(4), temporal_warp
0:36.441 aoe q arcane_explosion Fluffy_Pillow 55477.8/67366: 82% mana bloodlust, temporal_warp
0:37.212 aoe q arcane_explosion Fluffy_Pillow 51516.5/67366: 76% mana bloodlust, arcane_charge, temporal_warp
0:37.982 aoe q arcane_explosion Fluffy_Pillow 47554.0/67366: 71% mana bloodlust, arcane_charge(2), temporal_warp
0:38.753 aoe q arcane_explosion Fluffy_Pillow 43592.7/67366: 65% mana bloodlust, arcane_charge(3), temporal_warp
0:39.525 aoe r arcane_barrage Fluffy_Pillow 39632.9/67366: 59% mana bloodlust, arcane_charge(4), temporal_warp
0:40.295 aoe q arcane_explosion Fluffy_Pillow 43364.9/67366: 64% mana bloodlust, temporal_warp
0:41.064 aoe q arcane_explosion Fluffy_Pillow 39401.0/67366: 58% mana arcane_charge, temporal_warp
0:42.066 aoe q arcane_explosion Fluffy_Pillow 35751.0/67366: 53% mana arcane_charge(2)
0:43.366 aoe q arcane_explosion Fluffy_Pillow 32502.5/67366: 48% mana arcane_charge(3)
0:44.666 aoe r arcane_barrage Fluffy_Pillow 29254.0/67366: 43% mana arcane_charge(4)
0:45.966 aoe p arcane_orb Fluffy_Pillow 33700.2/67366: 50% mana
0:47.265 aoe r arcane_barrage Fluffy_Pillow 34950.3/67366: 52% mana arcane_charge(4)
0:48.564 aoe q arcane_explosion Fluffy_Pillow 39395.1/67366: 58% mana
0:49.863 aoe q arcane_explosion Fluffy_Pillow 36145.3/67366: 54% mana arcane_charge
0:51.163 aoe q arcane_explosion Fluffy_Pillow 32896.8/67366: 49% mana arcane_charge(2)
0:52.462 aoe q arcane_explosion Fluffy_Pillow 29647.0/67366: 44% mana arcane_charge(3)
0:53.763 aoe r arcane_barrage Fluffy_Pillow 26399.8/67366: 39% mana arcane_charge(4)
0:55.063 aoe q arcane_explosion Fluffy_Pillow 30846.0/67366: 46% mana
0:56.364 aoe q arcane_explosion Fluffy_Pillow 27598.8/67366: 41% mana arcane_charge
0:57.663 aoe q arcane_explosion Fluffy_Pillow 24349.0/67366: 36% mana arcane_charge(2)
0:58.961 aoe q arcane_explosion Fluffy_Pillow 21097.8/67366: 31% mana arcane_charge(3)
1:00.259 aoe r arcane_barrage Fluffy_Pillow 17846.6/67366: 26% mana arcane_charge(4), clearcasting
1:01.558 aoe k touch_of_the_magi Fluffy_Pillow 22291.4/67366: 33% mana clearcasting, crimson_chorus
1:02.858 aoe m rune_of_power Fluffy_Pillow 21542.9/67366: 32% mana arcane_charge(4), clearcasting, crimson_chorus
1:04.158 aoe r arcane_barrage Fluffy_Pillow 23294.4/67366: 35% mana arcane_charge(4), clearcasting, rune_of_power, crimson_chorus
1:05.459 aoe q arcane_explosion Fluffy_Pillow 27741.9/67366: 41% mana clearcasting, rune_of_power, crimson_chorus
1:06.758 aoe q arcane_explosion Fluffy_Pillow 29492.1/67366: 44% mana arcane_charge, rune_of_power, crimson_chorus
1:08.057 aoe q arcane_explosion Fluffy_Pillow 26242.2/67366: 39% mana arcane_charge(2), rune_of_power, crimson_chorus
1:09.357 aoe q arcane_explosion Fluffy_Pillow 22993.7/67366: 34% mana arcane_charge(3), rune_of_power, crimson_chorus
1:10.658 aoe r arcane_barrage Fluffy_Pillow 19746.6/67366: 29% mana arcane_charge(4), rune_of_power, crimson_chorus
1:11.958 aoe p arcane_orb Fluffy_Pillow 24192.7/67366: 36% mana rune_of_power, crimson_chorus(2)
1:13.258 aoe r arcane_barrage Fluffy_Pillow 25444.2/67366: 38% mana arcane_charge(4), rune_of_power, crimson_chorus(2)
1:14.559 aoe q arcane_explosion Fluffy_Pillow 29891.7/67366: 44% mana rune_of_power, crimson_chorus(2)
1:15.857 aoe q arcane_explosion Fluffy_Pillow 26640.5/67366: 40% mana arcane_charge, rune_of_power, crimson_chorus(2)
1:17.157 aoe q arcane_explosion Fluffy_Pillow 23392.0/67366: 35% mana arcane_charge(2), clearcasting, crimson_chorus(2)
1:18.456 aoe q arcane_explosion Fluffy_Pillow 25142.2/67366: 37% mana arcane_charge(3), crimson_chorus(2)
1:19.757 aoe r arcane_barrage Fluffy_Pillow 21895.1/67366: 33% mana arcane_charge(4), crimson_chorus(2)
1:21.055 aoe q arcane_explosion Fluffy_Pillow 26338.5/67366: 39% mana crimson_chorus(3)
1:22.354 aoe q arcane_explosion Fluffy_Pillow 23088.7/67366: 34% mana arcane_charge, clearcasting, crimson_chorus(3)
1:23.653 aoe q arcane_explosion Fluffy_Pillow 24838.8/67366: 37% mana arcane_charge(2), crimson_chorus(3)
1:24.950 aoe q arcane_explosion Fluffy_Pillow 21586.3/67366: 32% mana arcane_charge(3), crimson_chorus(3)
1:26.251 aoe r arcane_barrage Fluffy_Pillow 18339.1/67366: 27% mana arcane_charge(4), crimson_chorus(3)
1:27.550 aoe q arcane_explosion Fluffy_Pillow 22783.9/67366: 34% mana crimson_chorus(3)
1:28.850 aoe q arcane_explosion Fluffy_Pillow 19535.4/67366: 29% mana arcane_charge, crimson_chorus(3)
1:30.149 aoe q arcane_explosion Fluffy_Pillow 16285.6/67366: 24% mana arcane_charge(2), clearcasting, crimson_chorus(3)
1:31.448 aoe q arcane_explosion Fluffy_Pillow 18035.8/67366: 27% mana arcane_charge(3)
1:32.749 aoe r arcane_barrage Fluffy_Pillow 14788.6/67366: 22% mana arcane_charge(4)
1:34.048 aoe p arcane_orb Fluffy_Pillow 19233.4/67366: 29% mana
1:35.348 aoe r arcane_barrage Fluffy_Pillow 20484.9/67366: 30% mana arcane_charge(4)
1:36.647 aoe q arcane_explosion Fluffy_Pillow 24929.7/67366: 37% mana
1:37.946 aoe q arcane_explosion Fluffy_Pillow 21679.9/67366: 32% mana arcane_charge
1:39.246 aoe q arcane_explosion Fluffy_Pillow 18431.4/67366: 27% mana arcane_charge(2)
1:40.547 aoe q arcane_explosion Fluffy_Pillow 15184.2/67366: 23% mana arcane_charge(3)
1:41.848 aoe r arcane_barrage Fluffy_Pillow 11937.1/67366: 18% mana arcane_charge(4)
1:43.146 aoe q arcane_explosion Fluffy_Pillow 16380.5/67366: 24% mana
1:44.446 aoe q arcane_explosion Fluffy_Pillow 13132.0/67366: 19% mana arcane_charge
1:45.747 aoe q arcane_explosion Fluffy_Pillow 9884.9/67366: 15% mana arcane_charge(2)
1:47.046 aoe q arcane_explosion Fluffy_Pillow 6635.1/67366: 10% mana arcane_charge(3)
1:48.346 aoe r arcane_barrage Fluffy_Pillow 3386.6/67366: 5% mana arcane_charge(4)
1:49.646 aoe k touch_of_the_magi Fluffy_Pillow 7832.7/67366: 12% mana
1:50.944 aoe m rune_of_power Fluffy_Pillow 7081.5/67366: 11% mana arcane_charge(4)
1:52.242 aoe r arcane_barrage Fluffy_Pillow 8830.3/67366: 13% mana arcane_charge(4), rune_of_power
1:53.541 aoe q arcane_explosion Fluffy_Pillow 13275.1/67366: 20% mana rune_of_power
1:54.839 aoe q arcane_explosion Fluffy_Pillow 10023.9/67366: 15% mana arcane_charge, rune_of_power
1:56.138 aoe q arcane_explosion Fluffy_Pillow 6774.1/67366: 10% mana arcane_charge(2), rune_of_power
1:57.437 cooldowns t presence_of_mind Fluffy_Pillow 3524.3/67366: 5% mana arcane_charge(3), rune_of_power
1:57.437 rotation y arcane_barrage Fluffy_Pillow 3524.3/67366: 5% mana arcane_charge(3), presence_of_mind(3), rune_of_power
1:58.737 aoe p arcane_orb Fluffy_Pillow 7296.7/67366: 11% mana presence_of_mind(3), rune_of_power
2:00.035 aoe r arcane_barrage Fluffy_Pillow 8545.5/67366: 13% mana arcane_charge(4), presence_of_mind(3), rune_of_power
2:01.334 aoe q arcane_explosion Fluffy_Pillow 12990.3/67366: 19% mana presence_of_mind(3), rune_of_power
2:02.634 aoe q arcane_explosion Fluffy_Pillow 9741.8/67366: 14% mana arcane_charge, clearcasting, presence_of_mind(3), rune_of_power, crimson_chorus
2:03.932 shared_cds z use_mana_gem Necrolord_Emeni 11490.7/67366: 17% mana arcane_charge(2), presence_of_mind(3), rune_of_power, crimson_chorus
2:03.932 aoe q arcane_explosion Fluffy_Pillow 18227.2/67366: 27% mana arcane_charge(2), presence_of_mind(3), rune_of_power, crimson_chorus
2:05.230 aoe q arcane_explosion Fluffy_Pillow 14976.0/67366: 22% mana arcane_charge(3), presence_of_mind(3), crimson_chorus
2:06.529 aoe l arcane_power Fluffy_Pillow 11726.2/67366: 17% mana arcane_charge(4), presence_of_mind(3), crimson_chorus
2:06.529 shared_cds { use_items Fluffy_Pillow 11726.2/67366: 17% mana arcane_charge(4), arcane_power, presence_of_mind(3), rune_of_power, crimson_chorus
2:06.529 aoe r arcane_barrage Fluffy_Pillow 11726.2/67366: 17% mana arcane_charge(4), arcane_power, presence_of_mind(3), rune_of_power, crimson_chorus, gladiators_badge
2:07.827 aoe q arcane_explosion Fluffy_Pillow 16169.6/67366: 24% mana arcane_power, presence_of_mind(3), rune_of_power, crimson_chorus, gladiators_badge
2:09.127 aoe q arcane_explosion Fluffy_Pillow 15421.2/67366: 23% mana arcane_charge, arcane_power, presence_of_mind(3), rune_of_power, crimson_chorus, gladiators_badge
2:10.429 aoe q arcane_explosion Fluffy_Pillow 14675.4/67366: 22% mana arcane_charge(2), arcane_power, presence_of_mind(3), rune_of_power, crimson_chorus, gladiators_badge
2:11.730 aoe q arcane_explosion Fluffy_Pillow 13928.2/67366: 21% mana arcane_charge(3), arcane_power, clearcasting, presence_of_mind(3), rune_of_power, crimson_chorus(2), gladiators_badge
2:13.029 aoe r arcane_barrage Fluffy_Pillow 15678.4/67366: 23% mana arcane_charge(4), arcane_power, presence_of_mind(3), rune_of_power, crimson_chorus(2), gladiators_badge
2:14.330 aoe q arcane_explosion Fluffy_Pillow 20125.9/67366: 30% mana arcane_power, presence_of_mind(3), rune_of_power, crimson_chorus(2), gladiators_badge
2:15.629 aoe q arcane_explosion Fluffy_Pillow 19376.0/67366: 29% mana arcane_charge, arcane_power, presence_of_mind(3), rune_of_power, crimson_chorus(2), gladiators_badge
2:16.928 aoe q arcane_explosion Fluffy_Pillow 18626.2/67366: 28% mana arcane_charge(2), arcane_power, presence_of_mind(3), rune_of_power, crimson_chorus(2), gladiators_badge
2:18.227 aoe q arcane_explosion Fluffy_Pillow 17876.3/67366: 27% mana arcane_charge(3), arcane_power, presence_of_mind(3), rune_of_power, crimson_chorus(2), gladiators_badge
2:19.525 aoe r arcane_barrage Fluffy_Pillow 17125.2/67366: 25% mana arcane_charge(4), arcane_power, presence_of_mind(3), crimson_chorus(2), gladiators_badge
2:20.823 aoe p arcane_orb Fluffy_Pillow 21568.6/67366: 32% mana arcane_power, presence_of_mind(3), crimson_chorus(2), gladiators_badge
2:22.122 aoe r arcane_barrage Fluffy_Pillow 23068.8/67366: 34% mana arcane_charge(4), presence_of_mind(3), crimson_chorus(3)
2:23.419 aoe q arcane_explosion Fluffy_Pillow 27510.9/67366: 41% mana presence_of_mind(3), crimson_chorus(3)
2:24.717 aoe q arcane_explosion Fluffy_Pillow 24259.7/67366: 36% mana arcane_charge, presence_of_mind(3), crimson_chorus(3)
2:26.015 aoe q arcane_explosion Fluffy_Pillow 21008.5/67366: 31% mana arcane_charge(2), clearcasting, presence_of_mind(3), crimson_chorus(3)
2:27.315 aoe q arcane_explosion Fluffy_Pillow 22760.0/67366: 34% mana arcane_charge(3), presence_of_mind(3), crimson_chorus(3)
2:28.614 aoe r arcane_barrage Fluffy_Pillow 19510.2/67366: 29% mana arcane_charge(4), presence_of_mind(3), crimson_chorus(3)
2:29.913 aoe q arcane_explosion Fluffy_Pillow 23954.9/67366: 36% mana presence_of_mind(3), crimson_chorus(3)
2:31.212 aoe q arcane_explosion Fluffy_Pillow 20705.1/67366: 31% mana arcane_charge, presence_of_mind(3), crimson_chorus(3)
2:32.510 aoe q arcane_explosion Fluffy_Pillow 17453.9/67366: 26% mana arcane_charge(2), presence_of_mind(3)
2:33.809 aoe q arcane_explosion Fluffy_Pillow 14204.1/67366: 21% mana arcane_charge(3), presence_of_mind(3)
2:35.108 aoe r arcane_barrage Fluffy_Pillow 10954.2/67366: 16% mana arcane_charge(4), presence_of_mind(3)
2:36.408 aoe k touch_of_the_magi Fluffy_Pillow 15400.4/67366: 23% mana presence_of_mind(3)
2:37.708 aoe m rune_of_power Fluffy_Pillow 14651.9/67366: 22% mana arcane_charge(4), presence_of_mind(3)
2:39.009 aoe r arcane_barrage Fluffy_Pillow 16404.7/67366: 24% mana arcane_charge(4), presence_of_mind(3), rune_of_power
2:40.310 aoe q arcane_explosion Fluffy_Pillow 20852.2/67366: 31% mana presence_of_mind(3), rune_of_power
2:41.609 aoe q arcane_explosion Fluffy_Pillow 17602.4/67366: 26% mana arcane_charge, presence_of_mind(3), rune_of_power
2:42.908 aoe q arcane_explosion Fluffy_Pillow 14352.6/67366: 21% mana arcane_charge(2), clearcasting, presence_of_mind(3), rune_of_power
2:44.206 aoe q arcane_explosion Fluffy_Pillow 16101.4/67366: 24% mana arcane_charge(3), presence_of_mind(3), rune_of_power
2:45.506 aoe r arcane_barrage Fluffy_Pillow 12852.9/67366: 19% mana arcane_charge(4), presence_of_mind(3), rune_of_power
2:46.806 aoe p arcane_orb Fluffy_Pillow 17299.0/67366: 26% mana presence_of_mind(3), rune_of_power
2:48.107 aoe r arcane_barrage Fluffy_Pillow 18551.9/67366: 28% mana arcane_charge(4), presence_of_mind(3), rune_of_power
2:49.407 aoe q arcane_explosion Fluffy_Pillow 22998.0/67366: 34% mana presence_of_mind(3), rune_of_power
2:50.705 aoe q arcane_explosion Fluffy_Pillow 19746.8/67366: 29% mana arcane_charge, presence_of_mind(3), rune_of_power
2:52.005 aoe q arcane_explosion Fluffy_Pillow 16498.3/67366: 24% mana arcane_charge(2), presence_of_mind(3)
2:53.305 aoe q arcane_explosion Fluffy_Pillow 13249.8/67366: 20% mana arcane_charge(3), presence_of_mind(3)
2:54.605 aoe r arcane_barrage Fluffy_Pillow 10001.3/67366: 15% mana arcane_charge(4), presence_of_mind(3)
2:55.906 aoe q arcane_explosion Fluffy_Pillow 14448.8/67366: 21% mana presence_of_mind(3)
2:57.206 aoe q arcane_explosion Fluffy_Pillow 11200.3/67366: 17% mana arcane_charge, presence_of_mind(3)
2:58.506 aoe q arcane_explosion Fluffy_Pillow 7951.8/67366: 12% mana arcane_charge(2), presence_of_mind(3)
2:59.805 aoe s evocation Fluffy_Pillow 4702.0/67366: 7% mana arcane_charge(3), presence_of_mind(3)
3:04.125 aoe q arcane_explosion Fluffy_Pillow 61911.6/67366: 92% mana arcane_charge(3), presence_of_mind(3)
3:05.425 aoe r arcane_barrage Fluffy_Pillow 58663.2/67366: 87% mana arcane_charge(4), presence_of_mind(3), crimson_chorus
3:06.723 aoe p arcane_orb Fluffy_Pillow 63106.6/67366: 94% mana presence_of_mind(3), crimson_chorus
3:08.105 aoe r arcane_barrage Fluffy_Pillow 64468.6/67366: 96% mana arcane_charge(4), presence_of_mind(3), crimson_chorus
3:09.404 aoe q arcane_explosion Fluffy_Pillow 67365.7/67366: 100% mana presence_of_mind(3), crimson_chorus
3:10.704 aoe q arcane_explosion Fluffy_Pillow 64117.2/67366: 95% mana arcane_charge, presence_of_mind(3), crimson_chorus
3:12.004 aoe q arcane_explosion Fluffy_Pillow 60868.7/67366: 90% mana arcane_charge(2), presence_of_mind(3), crimson_chorus
3:13.304 aoe q arcane_explosion Fluffy_Pillow 57620.2/67366: 86% mana arcane_charge(3), clearcasting, presence_of_mind(3), crimson_chorus
3:14.605 aoe r arcane_barrage Fluffy_Pillow 59373.1/67366: 88% mana arcane_charge(4), presence_of_mind(3), crimson_chorus(2)
3:15.904 aoe q arcane_explosion Fluffy_Pillow 63817.9/67366: 95% mana presence_of_mind(3), crimson_chorus(2)
3:17.202 aoe q arcane_explosion Fluffy_Pillow 60566.7/67366: 90% mana arcane_charge, presence_of_mind(3), crimson_chorus(2)
3:18.502 aoe q arcane_explosion Fluffy_Pillow 57318.2/67366: 85% mana arcane_charge(2), presence_of_mind(3), crimson_chorus(2)
3:19.801 aoe q arcane_explosion Fluffy_Pillow 54068.4/67366: 80% mana arcane_charge(3), clearcasting, presence_of_mind(3), crimson_chorus(2)
3:21.100 aoe r arcane_barrage Fluffy_Pillow 55818.5/67366: 83% mana arcane_charge(4), presence_of_mind(3), crimson_chorus(2)
3:22.398 aoe q arcane_explosion Fluffy_Pillow 60262.0/67366: 89% mana presence_of_mind(3), crimson_chorus(2)
3:23.699 aoe k touch_of_the_magi Fluffy_Pillow 57014.8/67366: 85% mana arcane_charge, presence_of_mind(3), crimson_chorus(2)
3:24.997 aoe m rune_of_power Fluffy_Pillow 56263.6/67366: 84% mana arcane_charge(4), presence_of_mind(3), crimson_chorus(3)
3:26.297 aoe r arcane_barrage Fluffy_Pillow 58015.2/67366: 86% mana arcane_charge(4), presence_of_mind(3), rune_of_power, crimson_chorus(3)
3:27.596 aoe p arcane_orb Fluffy_Pillow 62459.9/67366: 93% mana presence_of_mind(3), rune_of_power, crimson_chorus(3)
3:28.894 aoe r arcane_barrage Fluffy_Pillow 63708.8/67366: 95% mana arcane_charge(4), presence_of_mind(3), rune_of_power, crimson_chorus(3)
3:30.193 aoe q arcane_explosion Fluffy_Pillow 67365.7/67366: 100% mana presence_of_mind(3), rune_of_power, crimson_chorus(3)
3:31.491 aoe q arcane_explosion Fluffy_Pillow 64114.5/67366: 95% mana arcane_charge, presence_of_mind(3), rune_of_power, crimson_chorus(3)
3:32.790 aoe q arcane_explosion Fluffy_Pillow 60864.7/67366: 90% mana arcane_charge(2), clearcasting, presence_of_mind(3), rune_of_power, crimson_chorus(3)
3:34.089 aoe q arcane_explosion Fluffy_Pillow 62614.9/67366: 93% mana arcane_charge(3), presence_of_mind(3), rune_of_power, crimson_chorus(3)
3:35.388 aoe r arcane_barrage Fluffy_Pillow 59365.0/67366: 88% mana arcane_charge(4), presence_of_mind(3), rune_of_power
3:36.689 aoe q arcane_explosion Fluffy_Pillow 63812.5/67366: 95% mana presence_of_mind(3), rune_of_power
3:37.988 aoe q arcane_explosion Fluffy_Pillow 60562.7/67366: 90% mana arcane_charge, presence_of_mind(3), rune_of_power
3:39.287 aoe q arcane_explosion Fluffy_Pillow 57312.8/67366: 85% mana arcane_charge(2), presence_of_mind(3)
3:40.586 aoe q arcane_explosion Fluffy_Pillow 54063.0/67366: 80% mana arcane_charge(3), presence_of_mind(3)
3:41.886 aoe r arcane_barrage Fluffy_Pillow 50814.5/67366: 75% mana arcane_charge(4), presence_of_mind(3)
3:43.187 aoe q arcane_explosion Fluffy_Pillow 55262.0/67366: 82% mana presence_of_mind(3)
3:44.487 aoe q arcane_explosion Fluffy_Pillow 52013.5/67366: 77% mana arcane_charge, presence_of_mind(3)
3:45.786 aoe q arcane_explosion Fluffy_Pillow 48763.6/67366: 72% mana arcane_charge(2), presence_of_mind(3)
3:47.086 aoe q arcane_explosion Fluffy_Pillow 45515.2/67366: 68% mana arcane_charge(3), presence_of_mind(3)
3:48.386 aoe r arcane_barrage Fluffy_Pillow 42266.7/67366: 63% mana arcane_charge(4), presence_of_mind(3)
3:49.685 aoe p arcane_orb Fluffy_Pillow 46711.5/67366: 69% mana presence_of_mind(3)
3:50.983 aoe r arcane_barrage Fluffy_Pillow 47960.3/67366: 71% mana arcane_charge(4), presence_of_mind(3)
3:52.283 aoe q arcane_explosion Fluffy_Pillow 52406.4/67366: 78% mana presence_of_mind(3)
3:53.582 aoe q arcane_explosion Fluffy_Pillow 49156.6/67366: 73% mana arcane_charge, presence_of_mind(3)
3:54.881 aoe q arcane_explosion Fluffy_Pillow 45906.7/67366: 68% mana arcane_charge(2), clearcasting, presence_of_mind(3)
3:56.179 aoe q arcane_explosion Fluffy_Pillow 47655.5/67366: 71% mana arcane_charge(3), presence_of_mind(3)
3:57.479 aoe r arcane_barrage Fluffy_Pillow 44407.0/67366: 66% mana arcane_charge(4), clearcasting, presence_of_mind(3)
3:58.780 aoe q arcane_explosion Fluffy_Pillow 48854.5/67366: 73% mana clearcasting, presence_of_mind(3)
4:00.078 aoe q arcane_explosion Fluffy_Pillow 50603.3/67366: 75% mana arcane_charge, presence_of_mind(3)
4:01.377 aoe q arcane_explosion Fluffy_Pillow 47353.5/67366: 70% mana arcane_charge(2), presence_of_mind(3)
4:02.676 aoe q arcane_explosion Fluffy_Pillow 44103.7/67366: 65% mana arcane_charge(3), presence_of_mind(3)
4:03.976 shared_cds z use_mana_gem Necrolord_Emeni 40855.2/67366: 61% mana arcane_charge(4), presence_of_mind(3)
4:03.976 aoe r arcane_barrage Fluffy_Pillow 47591.7/67366: 71% mana arcane_charge(4), presence_of_mind(3)
4:05.277 aoe q arcane_explosion Fluffy_Pillow 52039.2/67366: 77% mana presence_of_mind(3), crimson_chorus
4:06.575 aoe q arcane_explosion Fluffy_Pillow 48788.0/67366: 72% mana arcane_charge, presence_of_mind(3), crimson_chorus
4:07.874 aoe q arcane_explosion Fluffy_Pillow 45538.2/67366: 68% mana arcane_charge(2), presence_of_mind(3), crimson_chorus
4:09.172 aoe q arcane_explosion Fluffy_Pillow 42287.0/67366: 63% mana arcane_charge(3), presence_of_mind(3), crimson_chorus
4:10.471 aoe r arcane_barrage Fluffy_Pillow 39037.2/67366: 58% mana arcane_charge(4), presence_of_mind(3), crimson_chorus
4:11.772 aoe j deathborne Fluffy_Pillow 43484.7/67366: 65% mana presence_of_mind(3), crimson_chorus
4:13.072 aoe k touch_of_the_magi Fluffy_Pillow 42736.2/67366: 63% mana presence_of_mind(3), deathborne, crimson_chorus, lead_by_example
4:14.371 aoe l arcane_power Fluffy_Pillow 41986.3/67366: 62% mana arcane_charge(4), presence_of_mind(3), deathborne, crimson_chorus, lead_by_example
4:14.371 shared_cds { use_items Fluffy_Pillow 41986.3/67366: 62% mana arcane_charge(4), arcane_power, presence_of_mind(3), rune_of_power, deathborne, crimson_chorus, lead_by_example
4:14.371 shared_cds ~ berserking Fluffy_Pillow 41986.3/67366: 62% mana arcane_charge(4), arcane_power, presence_of_mind(3), rune_of_power, deathborne, crimson_chorus, lead_by_example, gladiators_badge
4:14.371 aoe o arcane_blast Fluffy_Pillow 41986.3/67366: 62% mana berserking, arcane_charge(4), arcane_power, presence_of_mind(3), rune_of_power, deathborne, crimson_chorus, lead_by_example, gladiators_badge
4:15.553 aoe o arcane_blast Fluffy_Pillow 40141.4/67366: 60% mana berserking, arcane_charge(4), arcane_power, presence_of_mind(2), rune_of_power, deathborne, crimson_chorus(2), lead_by_example, gladiators_badge
4:16.737 aoe o arcane_blast Fluffy_Pillow 38299.1/67366: 57% mana berserking, arcane_charge(4), arcane_power, presence_of_mind, rune_of_power, deathborne, crimson_chorus(2), lead_by_example, gladiators_badge
4:17.918 aoe o arcane_blast Fluffy_Pillow 36452.8/67366: 54% mana berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne, crimson_chorus(2), lead_by_example, gladiators_badge
4:19.125 aoe o arcane_blast Fluffy_Pillow 34641.5/67366: 51% mana berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne, crimson_chorus(2), lead_by_example, gladiators_badge
4:20.331 aoe o arcane_blast Fluffy_Pillow 32828.8/67366: 49% mana berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne, crimson_chorus(2), lead_by_example, gladiators_badge
4:21.536 aoe o arcane_blast Fluffy_Pillow 31014.8/67366: 46% mana berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne, crimson_chorus(2), lead_by_example, gladiators_badge
4:22.741 aoe o arcane_blast Fluffy_Pillow 29200.9/67366: 43% mana berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne, crimson_chorus(2), lead_by_example, gladiators_badge
4:23.946 aoe o arcane_blast Fluffy_Pillow 27386.9/67366: 41% mana berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne, crimson_chorus(2), lead_by_example, gladiators_badge
4:25.153 aoe o arcane_blast Fluffy_Pillow 25575.6/67366: 38% mana berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne, crimson_chorus(3), lead_by_example, gladiators_badge
4:26.359 aoe o arcane_blast Fluffy_Pillow 23762.9/67366: 35% mana berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne, crimson_chorus(3), lead_by_example, gladiators_badge
4:27.565 aoe m rune_of_power Fluffy_Pillow 21950.3/67366: 33% mana arcane_charge(4), arcane_power, deathborne, crimson_chorus(3), lead_by_example, gladiators_badge
4:28.866 aoe o arcane_blast Fluffy_Pillow 23703.2/67366: 35% mana arcane_charge(4), arcane_power, rune_of_power, deathborne, crimson_chorus(3), lead_by_example, gladiators_badge
4:30.193 aoe o arcane_blast Fluffy_Pillow 18616.0/67366: 28% mana arcane_charge(4), rune_of_power, deathborne, crimson_chorus(3), lead_by_example
4:31.518 aoe o arcane_blast Fluffy_Pillow 13526.2/67366: 20% mana arcane_charge(4), rune_of_power, deathborne, crimson_chorus(3), lead_by_example
4:32.844 aoe o arcane_blast Fluffy_Pillow 8437.8/67366: 13% mana arcane_charge(4), clearcasting, rune_of_power, deathborne, crimson_chorus(3), lead_by_example
4:34.168 aoe r arcane_barrage Fluffy_Pillow 3346.6/67366: 5% mana arcane_charge(4), clearcasting, rune_of_power, crimson_chorus(3), lead_by_example
4:35.467 aoe p arcane_orb Fluffy_Pillow 7791.4/67366: 12% mana clearcasting, rune_of_power, lead_by_example
4:36.767 aoe r arcane_barrage Fluffy_Pillow 9042.9/67366: 13% mana arcane_charge(4), clearcasting, rune_of_power, lead_by_example
4:38.067 aoe q arcane_explosion Fluffy_Pillow 13489.1/67366: 20% mana clearcasting, rune_of_power, lead_by_example
4:39.366 aoe q arcane_explosion Fluffy_Pillow 15239.2/67366: 23% mana arcane_charge, rune_of_power, lead_by_example
4:40.665 aoe q arcane_explosion Fluffy_Pillow 11989.4/67366: 18% mana arcane_charge(2), rune_of_power, lead_by_example
4:41.965 aoe q arcane_explosion Fluffy_Pillow 8740.9/67366: 13% mana arcane_charge(3), clearcasting, lead_by_example
4:43.265 aoe r arcane_barrage Fluffy_Pillow 10492.4/67366: 16% mana arcane_charge(4)
4:44.566 aoe q arcane_explosion Fluffy_Pillow 14939.9/67366: 22% mana
4:45.865 aoe q arcane_explosion Fluffy_Pillow 11690.0/67366: 17% mana arcane_charge
4:47.165 aoe q arcane_explosion Fluffy_Pillow 8441.5/67366: 13% mana arcane_charge(2)
4:48.465 aoe q arcane_explosion Fluffy_Pillow 5193.1/67366: 8% mana arcane_charge(3), clearcasting
4:49.766 aoe r arcane_barrage Fluffy_Pillow 6945.9/67366: 10% mana arcane_charge(4)
4:51.065 aoe q arcane_explosion Fluffy_Pillow 11390.7/67366: 17% mana
4:52.366 aoe q arcane_explosion Fluffy_Pillow 8143.6/67366: 12% mana arcane_charge
4:53.667 aoe s evocation Fluffy_Pillow 4896.4/67366: 7% mana arcane_charge(2)
4:57.985 aoe q arcane_explosion Fluffy_Pillow 62103.4/67366: 92% mana arcane_charge(2)
4:59.284 aoe q arcane_explosion Fluffy_Pillow 58853.5/67366: 87% mana arcane_charge(3)
5:00.584 aoe r arcane_barrage Fluffy_Pillow 55605.0/67366: 83% mana arcane_charge(4)
5:01.884 shared_cds } time_warp Fluffy_Pillow 60051.2/67366: 89% mana
5:01.884 aoe p arcane_orb Fluffy_Pillow 58051.2/67366: 86% mana temporal_warp
5:02.885 aoe r arcane_barrage Fluffy_Pillow 58899.8/67366: 87% mana arcane_charge(4), temporal_warp
5:03.885 aoe q arcane_explosion Fluffy_Pillow 62941.8/67366: 93% mana temporal_warp
5:04.885 aoe q arcane_explosion Fluffy_Pillow 59289.1/67366: 88% mana arcane_charge, temporal_warp
5:05.884 aoe q arcane_explosion Fluffy_Pillow 55635.0/67366: 83% mana arcane_charge(2), clearcasting, temporal_warp, crimson_chorus
5:06.883 aoe q arcane_explosion Fluffy_Pillow 56981.0/67366: 85% mana arcane_charge(3), temporal_warp, crimson_chorus
5:07.882 aoe r arcane_barrage Fluffy_Pillow 53327.0/67366: 79% mana arcane_charge(4), temporal_warp, crimson_chorus
5:08.882 aoe q arcane_explosion Fluffy_Pillow 57368.9/67366: 85% mana temporal_warp, crimson_chorus
5:09.883 aoe q arcane_explosion Fluffy_Pillow 53717.6/67366: 80% mana arcane_charge, temporal_warp, crimson_chorus
5:10.884 aoe q arcane_explosion Fluffy_Pillow 50066.2/67366: 74% mana arcane_charge(2), clearcasting, temporal_warp, crimson_chorus
5:11.883 aoe q arcane_explosion Fluffy_Pillow 51412.2/67366: 76% mana arcane_charge(3), temporal_warp, crimson_chorus
5:12.885 aoe r arcane_barrage Fluffy_Pillow 47762.2/67366: 71% mana arcane_charge(4), temporal_warp, crimson_chorus
5:13.885 aoe k touch_of_the_magi Fluffy_Pillow 51804.2/67366: 77% mana temporal_warp, crimson_chorus
5:14.885 aoe m rune_of_power Fluffy_Pillow 50651.5/67366: 75% mana arcane_charge(4), temporal_warp, crimson_chorus(2)
5:15.886 aoe r arcane_barrage Fluffy_Pillow 52000.1/67366: 77% mana arcane_charge(4), rune_of_power, temporal_warp, crimson_chorus(2)
5:16.886 aoe q arcane_explosion Fluffy_Pillow 56042.1/67366: 83% mana rune_of_power, temporal_warp, crimson_chorus(2)
5:17.887 aoe q arcane_explosion Fluffy_Pillow 52390.7/67366: 78% mana arcane_charge, rune_of_power, temporal_warp, crimson_chorus(2)
5:18.888 aoe q arcane_explosion Fluffy_Pillow 48739.4/67366: 72% mana arcane_charge(2), rune_of_power, temporal_warp, crimson_chorus(2)
5:19.887 aoe q arcane_explosion Fluffy_Pillow 45085.4/67366: 67% mana arcane_charge(3), rune_of_power, temporal_warp, crimson_chorus(2)
5:20.887 aoe r arcane_barrage Fluffy_Pillow 41432.7/67366: 62% mana arcane_charge(4), rune_of_power, temporal_warp, crimson_chorus(2)
5:21.887 aoe p arcane_orb Fluffy_Pillow 45474.6/67366: 68% mana rune_of_power, temporal_warp, crimson_chorus(2)
5:22.887 aoe r arcane_barrage Fluffy_Pillow 46321.9/67366: 69% mana arcane_charge(4), rune_of_power, temporal_warp, crimson_chorus(2)
5:23.887 aoe q arcane_explosion Fluffy_Pillow 50363.9/67366: 75% mana rune_of_power, temporal_warp, crimson_chorus(2)
5:24.888 aoe q arcane_explosion Fluffy_Pillow 46712.6/67366: 69% mana arcane_charge, clearcasting, rune_of_power, temporal_warp, crimson_chorus(3)
5:25.889 aoe q arcane_explosion Fluffy_Pillow 48061.2/67366: 71% mana arcane_charge(2), rune_of_power, temporal_warp, crimson_chorus(3)
5:26.889 aoe q arcane_explosion Fluffy_Pillow 44408.5/67366: 66% mana arcane_charge(3), rune_of_power, temporal_warp, crimson_chorus(3)
5:27.889 aoe r arcane_barrage Fluffy_Pillow 40755.8/67366: 60% mana arcane_charge(4), temporal_warp, crimson_chorus(3)
5:28.889 aoe q arcane_explosion Fluffy_Pillow 44797.8/67366: 66% mana temporal_warp, crimson_chorus(3)
5:29.888 aoe q arcane_explosion Fluffy_Pillow 41143.8/67366: 61% mana arcane_charge, clearcasting, temporal_warp, crimson_chorus(3)
5:30.890 aoe q arcane_explosion Fluffy_Pillow 42493.8/67366: 63% mana arcane_charge(2), temporal_warp, crimson_chorus(3)
5:31.891 aoe q arcane_explosion Fluffy_Pillow 38842.4/67366: 58% mana arcane_charge(3), clearcasting, temporal_warp, crimson_chorus(3)
5:32.892 aoe r arcane_barrage Fluffy_Pillow 40191.1/67366: 60% mana arcane_charge(4), temporal_warp, crimson_chorus(3)
5:33.893 aoe q arcane_explosion Fluffy_Pillow 44234.4/67366: 66% mana temporal_warp, crimson_chorus(3)
5:34.893 aoe q arcane_explosion Fluffy_Pillow 40581.7/67366: 60% mana arcane_charge, temporal_warp
5:35.894 aoe q arcane_explosion Fluffy_Pillow 36930.4/67366: 55% mana arcane_charge(2), temporal_warp
5:36.894 aoe q arcane_explosion Fluffy_Pillow 33277.7/67366: 49% mana arcane_charge(3), temporal_warp
5:37.896 aoe r arcane_barrage Fluffy_Pillow 29627.7/67366: 44% mana arcane_charge(4), temporal_warp
5:38.897 aoe q arcane_explosion Fluffy_Pillow 33671.0/67366: 50% mana temporal_warp
5:39.896 aoe q arcane_explosion Fluffy_Pillow 30016.9/67366: 45% mana arcane_charge, clearcasting, temporal_warp
5:40.896 aoe q arcane_explosion Fluffy_Pillow 31364.2/67366: 47% mana arcane_charge(2), temporal_warp
5:41.897 aoe q arcane_explosion Fluffy_Pillow 27712.9/67366: 41% mana arcane_charge(3)
5:43.196 aoe r arcane_barrage Fluffy_Pillow 24463.1/67366: 36% mana arcane_charge(4)
5:44.496 aoe p arcane_orb Fluffy_Pillow 28909.2/67366: 43% mana
5:45.795 aoe r arcane_barrage Fluffy_Pillow 30159.4/67366: 45% mana arcane_charge(4)
5:47.097 aoe q arcane_explosion Fluffy_Pillow 34608.2/67366: 51% mana
5:48.397 aoe q arcane_explosion Fluffy_Pillow 31359.7/67366: 47% mana arcane_charge
5:49.696 aoe q arcane_explosion Fluffy_Pillow 28109.9/67366: 42% mana arcane_charge(2)

Stats

Level Bonus (60) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 198 1 199 199 0
Agility 306 2 308 308 0
Stamina 414 0 2013 1918 1504
Intellect 450 -3 1767 1588 1066 (46)
Spirit 0 0 0 0 0
Health 40260 38360 0
Mana 67366 67366 0
Spell Power 1767 1588 0
Crit 15.74% 15.74% 376
Haste 15.76% 15.76% 520
Versatility 7.97% 7.97% 319
Mana Regen 1347 1347 0
Mastery 34.73% 34.73% 733
Armor 369 369 369
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 227.00
Local Head Confidant's Favored Cap
ilevel: 226, stats: { 44 Armor, +82 Int, +149 Sta, +44 Haste, +98 Mastery }
Local Neck Noble's Birthstone Pendant
ilevel: 226, stats: { +84 Sta, +52 Crit, +162 Mastery }
Local Shoulders Shawl of the Penitent
ilevel: 233, stats: { 42 Armor, +65 Int, +122 Sta, +33 Crit, +76 Haste }
Local Chest Robes of the Cursed Commando
ilevel: 233, stats: { 61 Armor, +87 Int, +162 Sta, +47 Crit, +100 Haste }, enchant: { +20 Int }
Local Waist Cinch of Infinite Tightness
ilevel: 226, stats: { 33 Armor, +61 Int, +112 Sta, +69 Crit, +36 Vers }
Local Legs Courtier's Costume Trousers
ilevel: 226, stats: { 51 Armor, +82 Int, +149 Sta, +49 Vers, +93 Mastery }
Local Feet Slippers of the Forgotten Heretic
ilevel: 226, stats: { 36 Armor, +61 Int, +112 Sta, +73 Crit, +32 Mastery }
Local Wrists Acolyte's Velvet Bindings
ilevel: 226, stats: { 29 Armor, +46 Int, +84 Sta, +26 Vers, +53 Mastery }, enchant: { +15 Int }
Local Hands Impossibly Oversized Mitts
ilevel: 226, stats: { 33 Armor, +61 Int, +112 Sta, +31 Haste, +74 Mastery }
Local Finger1 Most Regal Signet of Sire Denathrius
ilevel: 233, stats: { +91 Sta, +178 Haste, +48 Mastery }, enchant: { +16 Mastery }
item effects: { equip: Denathrius' Privilege }
Local Finger2 Shadowghast Ring
ilevel: 235, stats: { +94 Sta, +115 Mastery, +115 Vers }, enchant: { +16 Mastery }
item effects: { equip: Temporal Warp }
Local Trinket1 Cabalist's Hymnal
ilevel: 226, stats: { +77 Int }
item effects: { equip: Crimson Chorus }
Local Trinket2 Sinful Aspirant's Badge of Ferocity
ilevel: 207, stats: { +91 Haste }
item effects: { use: Gladiator's Badge }
Local Back Mantle of Manifest Sins
ilevel: 226, stats: { 40 Armor, +84 Sta, +53 Crit, +26 Mastery, +46 StrAgiInt }
Local Main Hand Staff of the Penitent
ilevel: 226, weapon: { 93 - 128, 3.6 }, stats: { +82 Int, +281 Int, +149 Sta, +49 Crit, +93 Vers }, enchant: sinful_revelation

Profile

mage="Necrolord_Emeni"
source=default
spec=arcane
level=60
race=troll
role=spell
position=back
talents=1031021
talent_override=resonance,if=3>2
covenant=necrolord
soulbind=342156//51:6

# Default consumables
potion=deathly_fixation
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=variable,name=prepull_evo,op=reset,default=0
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
actions.precombat+=/variable,name=have_opened,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
actions.precombat+=/variable,name=final_burn,op=set,value=0
actions.precombat+=/variable,name=rs_max_delay,op=reset,default=5
actions.precombat+=/variable,name=ap_max_delay,op=reset,default=10
actions.precombat+=/variable,name=rop_max_delay,op=reset,default=20
actions.precombat+=/variable,name=totm_max_delay,op=reset,default=5
actions.precombat+=/variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
actions.precombat+=/variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
actions.precombat+=/variable,name=barrage_mana_pct,op=reset,default=70
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=reset,default=30
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
actions.precombat+=/variable,name=totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=aoe_totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=am_spam,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
actions.precombat+=/variable,name=am_spam_evo_pct,op=reset,default=15
actions.precombat+=/flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_familiar
actions.precombat+=/arcane_intellect
actions.precombat+=/conjure_mana_gem
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/frostbolt,if=variable.prepull_evo<=0
actions.precombat+=/evocation,if=variable.prepull_evo>0

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/call_action_list,name=shared_cds
actions+=/call_action_list,name=essences
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/call_action_list,name=opener,if=variable.have_opened<=0
actions+=/call_action_list,name=am_spam,if=variable.am_spam=1
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=rotation,if=variable.final_burn=0
actions+=/call_action_list,name=final_burn,if=variable.final_burn=1
actions+=/call_action_list,name=movement

actions.am_spam=cancel_action,if=action.evocation.channeling&mana.pct>=95
actions.am_spam+=/evocation,if=mana.pct<=variable.am_spam_evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/rune_of_power,if=buff.rune_of_power.down&cooldown.arcane_power.remains>0
actions.am_spam+=/touch_of_the_magi,if=(cooldown.arcane_power.remains=0&buff.rune_of_power.down)|prev_gcd.1.rune_of_power
actions.am_spam+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&buff.rune_of_power.down&essence.vision_of_perfection.enabled
actions.am_spam+=/arcane_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.ap_max_delay
actions.am_spam+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=action.arcane_missiles.execute_time&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_barrage,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_missiles,if=buff.clearcasting.react,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/arcane_missiles,if=!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.am_spam+=/arcane_barrage
actions.am_spam+=/arcane_blast

actions.aoe=frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
actions.aoe+=/arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
actions.aoe+=/mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
actions.aoe+=/arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
actions.aoe+=/rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
actions.aoe+=/presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
actions.aoe+=/arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
actions.aoe+=/supernova
actions.aoe+=/arcane_orb,if=buff.arcane_charge.stack=0
actions.aoe+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
actions.aoe+=/arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1

# Prioritize using grisly icicle with ap. Use it with totm otherwise.
actions.cooldowns=frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.cooldowns+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
# Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
# Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
actions.cooldowns+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
# Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
# Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
# Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
actions.cooldowns+=/arcane_power,if=(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
actions.cooldowns+=/rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
# Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
actions.cooldowns+=/presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
# Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.cooldowns+=/presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled

actions.essences=blood_of_the_enemy,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/blood_of_the_enemy,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains>=50&cooldown.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay
actions.essences+=/worldvein_resonance,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/guardian_of_azeroth,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/guardian_of_azeroth,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/concentrated_flame,line_cd=6,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/reaping_flames,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/focused_azerite_beam,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/purifying_blast,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/ripple_in_space,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/the_unbound_force,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/memory_of_lucid_dreams,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down

actions.final_burn=arcane_missiles,if=buff.clearcasting.react,chain=1
actions.final_burn+=/arcane_blast
actions.final_burn+=/arcane_barrage

actions.movement=blink_any,if=movement.distance>=10
actions.movement+=/presence_of_mind
actions.movement+=/arcane_missiles,if=movement.distance<10
actions.movement+=/arcane_orb
actions.movement+=/fire_blast

actions.opener=variable,name=have_opened,op=set,value=1,if=prev_gcd.1.evocation
actions.opener+=/fire_blast,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command_frost.up
actions.opener+=/frost_nova,if=runeforge.grisly_icicle.equipped&mana.pct>95
actions.opener+=/mirrors_of_torment
actions.opener+=/deathborne
actions.opener+=/radiant_spark,if=mana.pct>40
actions.opener+=/cancel_action,if=action.shifting_power.channeling&gcd.remains=0
actions.opener+=/shifting_power,if=soulbind.field_of_blossoms.enabled
actions.opener+=/touch_of_the_magi
actions.opener+=/arcane_power
actions.opener+=/rune_of_power,if=buff.rune_of_power.down
actions.opener+=/presence_of_mind
actions.opener+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.opener+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.opener+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.opener+=/arcane_missiles,if=buff.clearcasting.react,chain=1
actions.opener+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges&(cooldown.arcane_power.remains>10|active_enemies<=2)
actions.opener+=/arcane_blast,if=buff.rune_of_power.up|mana.pct>15
actions.opener+=/evocation,if=buff.rune_of_power.down,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.opener+=/arcane_barrage

actions.rotation=variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
actions.rotation+=/strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
actions.rotation+=/arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
actions.rotation+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.rotation+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.rotation+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
actions.rotation+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
actions.rotation+=/supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.rotation+=/arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
actions.rotation+=/arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_blast
actions.rotation+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.rotation+=/arcane_barrage

actions.shared_cds=use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
actions.shared_cds+=/use_items,if=buff.arcane_power.up
actions.shared_cds+=/potion,if=buff.arcane_power.up
actions.shared_cds+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
actions.shared_cds+=/lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/berserking,if=buff.arcane_power.up
actions.shared_cds+=/blood_fury,if=buff.arcane_power.up
actions.shared_cds+=/fireblood,if=buff.arcane_power.up
actions.shared_cds+=/ancestral_call,if=buff.arcane_power.up

head=confidants_favored_cap,id=183021,bonus_id=1498,ilevel=226
neck=nobles_birthstone_pendant,id=183039,bonus_id=1498,ilevel=226
shoulders=shawl_of_the_penitent,id=183020,bonus_id=1498,ilevel=233
back=mantle_of_manifest_sins,id=183033,bonus_id=1498,ilevel=226
chest=robes_of_the_cursed_commando,id=182998,bonus_id=1498,ilevel=233,enchant=eternal_insight
wrists=acolytes_velvet_bindings,id=183017,bonus_id=1498,ilevel=226,enchant=eternal_intellect
hands=impossibly_oversized_mitts,id=183022,bonus_id=1498,ilevel=226
waist=cinch_of_infinite_tightness,id=183028,bonus_id=1498,ilevel=226
legs=courtiers_costume_trousers,id=183011,bonus_id=1498,ilevel=226
feet=slippers_of_the_forgotten_heretic,id=182979,bonus_id=1498,ilevel=226
finger1=most_regal_signet_of_sire_denathrius,id=183036,bonus_id=1498,ilevel=233,enchant=16mastery
finger2=shadowghast_ring,id=178926,bonus_id=6648/6650/6758/6834/1532,ilevel=235,enchant=16mastery
trinket1=cabalists_hymnal,id=184028,bonus_id=1498,ilevel=226
trinket2=sinful_aspirants_badge_of_ferocity,id=175884,bonus_id=1521,ilevel=207
main_hand=staff_of_the_penitent,id=180000,bonus_id=7187/6652/1524,ilevel=226,enchant=sinful_revelation

# Gear Summary
# gear_ilvl=226.73
# gear_stamina=1504
# gear_intellect=1066
# gear_crit_rating=376
# gear_haste_rating=520
# gear_mastery_rating=733
# gear_versatility_rating=319
# gear_armor=369

Necrolord_Marileth : 9239 dps, 4044 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
9239.4 9239.4 15.7 / 0.169% 1107.5 / 12.0% 3.9
RPS Out RPS In Primary Resource Waiting APM Active Skill
2337.9 2211.9 Mana 0.00% 53.2 100.0% 100%
Talents
Necrolord
Runeforge

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Necrolord_Marileth 9239
Arcane Barrage 2444 26.5% 52.0 5.41sec 14085 11529 Direct 155.8 3958 8031 4703 18.3%

Stats Details: Arcane Barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 52.02 155.79 0.00 0.00 1.2217 0.0000 732643.83 732643.83 0.00% 11528.62 11528.62
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.71% 127.29 95 167 3957.92 1052 16004 3959.64 3622 4332 503728 503728 0.00%
crit 18.29% 28.50 13 48 8031.13 2103 32009 8037.23 5563 10972 228916 228916 0.00%

Action Details: Arcane Barrage

  • id:44425
  • school:arcane
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.728000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=0 + 72.8%} Arcane damage. For each Arcane Charge, deals {$36032s2=30}% additional damage$?a321526[, grants you {$321526s1=2}% of your maximum mana,][]$?a231564[ and hits {$36032s3=0} additional nearby $Ltarget:targets; for {$s2=40}% of its damage][]. |cFFFFFFFFConsumes all Arcane Charges.|r

Action Priority List

    aoe
    [r]:51.68
  • if_expr:buff.arcane_charge.stack=buff.arcane_charge.max_stack
    rotation
    [u]:0.01
  • if_expr:cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
    rotation
    [y]:0.31
Arcane Blast 2657 28.8% 34.2 7.12sec 23328 24829 Direct 99.0 6709 13277 8050 20.4%

Stats Details: Arcane Blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 34.17 99.00 0.00 0.00 0.9396 0.0000 797052.87 797052.87 0.00% 24828.76 24828.76
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.58% 78.79 46 101 6709.19 581 11137 6715.70 5703 7380 528639 528639 0.00%
crit 20.42% 20.21 5 36 13277.01 1163 22275 13299.45 8667 17000 268414 268414 0.00%

Action Details: Arcane Blast

  • id:30451
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1375.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.457000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:30451
  • name:Arcane Blast
  • school:arcane
  • tooltip:
  • description:Blasts the target with energy, dealing {$30451s1=0 + 45.7%} Arcane damage. Each Arcane Charge increases damage by {$36032s1=60}% and mana cost by {$36032s5=100}%, and reduces cast time by {$36032s4=8}%. |cFFFFFFFFGenerates 1 Arcane Charge.|r

Action Priority List

    aoe
    [o]:34.17
  • if_expr:buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
    rotation
    [v]:0.00
  • if_expr:buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
    rotation
    [x]:0.15
Arcane Explosion 2771 30.0% 136.8 2.02sec 6068 4982 Direct 410.4 1703 3446 2023 18.3%

Stats Details: Arcane Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 136.81 410.43 0.00 0.00 1.2180 0.0000 830118.06 830118.06 0.00% 4981.68 4981.68
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.67% 335.22 257 431 1703.25 1427 3855 1704.91 1651 1775 570949 570949 0.00%
crit 18.33% 75.22 44 111 3445.74 2855 7710 3449.23 3049 3904 259169 259169 0.00%

Action Details: Arcane Explosion

  • id:1449
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.502320
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s2=0 + 50.2%} Arcane damage to all enemies within $A2 yards.$?a137021[ |cFFFFFFFFGenerates {$s1=1} Arcane Charge if any targets are hit.|r][]

Action Priority List

    aoe
    [q]:136.77
  • if_expr:buff.arcane_charge.stack<buff.arcane_charge.max_stack
Arcane Orb 0 (495) 0.0% (5.4%) 11.6 24.67sec 12803 10318

Stats Details: Arcane Orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.59 0.00 0.00 0.00 1.2408 0.0000 0.00 0.00 0.00% 10318.44 10318.44

Action Details: Arcane Orb

  • id:153626
  • school:arcane
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:153626
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r

Action Priority List

    aoe
    [p]:11.54
  • if_expr:buff.arcane_charge.stack=0
    rotation
    [w]:0.04
  • if_expr:buff.arcane_charge.stack<=variable.totm_max_charges
    Arcane Orb (_bolt) 495 5.4% 34.7 24.67sec 4272 0 Direct 34.7 3593 7350 4273 18.1%

Stats Details: Arcane Orb Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 34.73 34.73 0.00 0.00 0.0000 0.0000 148389.49 148389.49 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.90% 28.45 15 41 3592.56 2821 7619 3592.46 3008 3992 102174 102174 0.00%
crit 18.10% 6.29 0 15 7350.44 5642 15237 7356.66 0 10268 46215 46215 0.00%

Action Details: Arcane Orb Bolt

  • id:153640
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.092000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:153640
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:{$@spelldesc153626=Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r}
Deathly Fixation 0 (82) 0.0% (0.9%) 17.5 1.42sec 1379 0

Stats Details: Deathly Fixation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.55 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Deathly Fixation

  • id:322253
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:42.90
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322253
  • name:Deathly Fixation
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1.
  • description:Deal {$s1=43} Shadow damage every $t1. Stacks up to 5 times.
    Deathly Eruption 82 0.9% 17.5 1.42sec 1379 0 Direct 17.5 1137 2276 1379 21.3%

Stats Details: Deathly Eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.55 17.55 0.00 0.00 0.0000 0.0000 24197.26 24197.26 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.72% 13.81 5 22 1136.76 1117 1184 1136.76 1117 1184 15702 15702 0.00%
crit 21.28% 3.73 0 11 2275.55 2233 2367 2235.41 0 2367 8495 8495 0.00%

Action Details: Deathly Eruption

  • id:322256
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:984.99
  • base_dd_max:984.99
  • base_dd_mult:1.00

Spelldata

  • id:322256
  • name:Deathly Eruption
  • school:shadow
  • tooltip:
  • description:Deal {$s1=985} Shadow damage.
Eternal Insight 39 0.4% 21.4 13.84sec 553 0 Direct 21.4 464 929 553 19.2%

Stats Details: Eternal Insight

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 21.38 21.38 0.00 0.00 0.0000 0.0000 11833.37 11833.37 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.82% 17.28 7 33 464.36 453 481 464.38 453 476 8023 8023 0.00%
crit 19.18% 4.10 0 11 928.93 907 961 915.08 0 961 3810 3810 0.00%

Action Details: Eternal Insight

  • id:342314
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:400.00
  • base_dd_max:400.00
  • base_dd_mult:1.00

Spelldata

  • id:342314
  • name:Eternal Insight
  • school:shadow
  • tooltip:
  • description:Deals {$s1=400} Shadow damage.
Frostbolt 4 0.0% 0.0 0.00sec 0 0 Direct 1.0 1024 2047 1211 18.3%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 1.00 0.00 0.00 0.0000 0.0000 1211.51 1211.51 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.65% 0.82 0 1 1023.69 1024 1024 835.87 0 1024 836 836 0.00%
crit 18.35% 0.18 0 1 2047.39 2047 2047 375.64 0 2047 376 376 0.00%

Action Details: Frostbolt

  • id:116
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.511000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116
  • name:Frostbolt
  • school:frost
  • tooltip:
  • description:Launches a bolt of frost at the enemy, causing {$228597s1=0} Frost damage and slowing movement speed by {$205708s1=50}% for {$205708d=8 seconds}.
Mirror Image 0 (19) 0.0% (0.2%) 1.0 0.00sec 5712 0

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.
    Frostbolt (mirror_image) 143  / 19 0.2% 117.0 0.99sec 49 48 Direct 117.0 41 82 49 19.9%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 117.00 117.00 0.00 0.00 1.0091 0.0000 5712.00 5712.00 0.00% 48.38 48.38
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.06% 93.67 80 107 40.58 30 51 40.58 39 42 3801 3801 0.00%
crit 19.94% 23.33 10 37 81.92 59 101 81.94 70 94 1911 1911 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:40.00
Touch of the Magi 0 (727) 0.0% (7.9%) 6.2 51.52sec 35146 29347

Stats Details: Touch Of The Magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.21 0.00 0.00 0.00 1.1977 0.0000 0.00 0.00 0.00% 29347.39 29347.39

Action Details: Touch Of The Magi

  • id:321507
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:4.0

Spelldata

  • id:321507
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]

Action Priority List

    aoe
    [k]:6.23
  • if_expr:buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
    Touch of the Magi (_explosion) 727 7.9% 6.2 51.44sec 35146 0 Direct 18.6 11762 0 11762 0.0%

Stats Details: Touch Of The Magi Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.21 18.56 0.00 0.00 0.0000 0.0000 218256.52 218256.52 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 18.56 15 21 11761.87 1480 64374 11733.76 8370 14909 218257 218257 0.00%

Action Details: Touch Of The Magi Explosion

  • id:210833
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:12432.05
  • base_dd_max:12432.05
  • base_dd_mult:1.00

Spelldata

  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc321507=Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]}
Simple Action Stats Execute Interval
Necrolord_Marileth
Arcane Power 2.9 126.96sec

Stats Details: Arcane Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.87 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Power

  • id:12042
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].

Action Priority List

    aoe
    [l]:2.87
  • if_expr:((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
Berserking 1.9 254.15sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.87 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    shared_cds
    [~]:1.87
  • if_expr:buff.arcane_power.up
Conjure Mana Gem 1.0 0.00sec

Stats Details: Conjure Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Conjure Mana Gem

  • id:759
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:9000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:759
  • name:Conjure Mana Gem
  • school:arcane
  • tooltip:
  • description:Conjures a Mana Gem that can be used to instantly restore {$5405s1=10}% mana, and holds up to {$s2=3} charges. $@spellname118812 {$@spelldesc118812=Conjured items disappear if logged out for more than 15 minutes.}
Deathborne 1.9 253.65sec

Stats Details: Deathborne

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.88 0.00 0.00 0.00 1.2995 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Deathborne

  • id:324220
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:324220
  • name:Deathborne
  • school:shadow
  • tooltip:Transformed into a powerful skeletal mage, greatly enhancing your Frostbolt, Fireball, and Arcane Blast and increasing your spell damage by {$s2=10}%.
  • description:Transform into a powerful skeletal mage for {$d=20 seconds}. While in the form of a skeletal mage, your Frostbolt, Fireball, and Arcane Blast hit up to {$s4=2} enemies near your target and your spell damage is increased by {$s2=10}%.

Action Priority List

    aoe
    [j]:1.89
  • if_expr:cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
Evocation 2.0 184.99sec

Stats Details: Evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.96 0.00 11.68 0.00 3.2900 0.5503 0.00 0.00 0.00% 0.00 0.00

Action Details: Evocation

  • id:12051
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Necrolord_Marileth
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.

Action Priority List

    aoe
    [s]:1.96
  • interrupt_if_expr:mana.pct>=85
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Necrolord_Marileth
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Necrolord_Marileth
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Deathly Fixation (potion) 1.0 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307497
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    shared_cds
    [|]:1.00
  • if_expr:buff.arcane_power.up
Presence of Mind 1.8 244.29sec

Stats Details: Presence Of Mind

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.85 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Presence Of Mind

  • id:205025
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:60.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:205025
  • name:Presence of Mind
  • school:arcane
  • tooltip:Arcane Blast is instant cast.
  • description:Causes your next $n Arcane Blasts to be instant cast.

Action Priority List

    aoe
    [n]:1.80
  • if_expr:buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
    cooldowns
    [t]:0.05
  • if_expr:debuff.touch_of_the_magi.up&!covenant.kyrian.enabled
Rune of Power 6.1 50.53sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.08 0.00 0.00 0.00 1.1960 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    aoe
    [m]:6.10
  • if_expr:buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Time Warp 1.5 300.40sec

Stats Details: Time Warp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.49 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Time Warp

  • id:80353
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:2000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:80353
  • name:Time Warp
  • school:arcane
  • tooltip:Haste increased by $w1%. $?$W4>0[Time rate increased by $w4%.][]$?$W3=1[ When the effect ends, you die.][]
  • description:Warp the flow of time, increasing haste by {$s1=30}% $?a320919[and time rate by {$s4=0}% ][]for all party and raid members for {$d=40 seconds}. Allies will be unable to benefit from Bloodlust, Heroism, or Time Warp again for {$57724d=600 seconds}.$?a320920[ When the effect ends, you die.][]

Action Priority List

    shared_cds
    [}]:1.49
  • if_expr:runeforge.temporal_warp.equipped&buff.exhaustion.up
Replenish Mana (use_mana_gem) 2.9 121.18sec

Stats Details: Use Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.95 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Use Mana Gem

  • id:5405
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Necrolord_Marileth
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5405
  • name:Replenish Mana
  • school:physical
  • tooltip:Restoring $w2 mana every $t1 sec.
  • description:Restores {$s1=10}% mana.

Action Priority List

    shared_cds
    [z]:2.95
  • if_expr:(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Arcane Charge 52.8 170.7 5.7sec 1.3sec 4.3sec 75.24% 0.00% 32.4 (32.5) 0.0

Buff Details

  • buff initial source:Necrolord_Marileth
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.5s / 25.0s
  • trigger_min/max:0.0s / 6.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 23.7s

Stack Uptimes

  • arcane_charge_1:16.72%
  • arcane_charge_2:14.95%
  • arcane_charge_3:14.90%
  • arcane_charge_4:28.66%

Spelldata

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 2.9 0.0 127.0sec 127.0sec 14.7sec 14.06% 0.00% 0.0 (0.0) 2.7

Buff Details

  • buff initial source:Necrolord_Marileth
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:121.8s / 135.6s
  • trigger_min/max:121.8s / 135.6s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 15.0s

Stack Uptimes

  • arcane_power_1:14.06%

Spelldata

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Berserking 1.9 0.0 254.2sec 254.2sec 11.7sec 7.25% 22.25% 0.0 (0.0) 1.8

Buff Details

  • buff initial source:Necrolord_Marileth
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:249.7s / 258.8s
  • trigger_min/max:249.7s / 258.8s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s

Stack Uptimes

  • berserking_1:7.25%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.51% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Necrolord_Marileth
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.51%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Clearcasting 23.7 4.0 12.4sec 10.6sec 3.0sec 23.41% 0.00% 1.4 (1.4) 0.2

Buff Details

  • buff initial source:Necrolord_Marileth
  • cooldown name:buff_clearcasting
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • clearcasting_1:17.55%
  • clearcasting_2:2.82%
  • clearcasting_3:3.03%

Spelldata

  • id:263725
  • name:Clearcasting
  • tooltip:Your next Arcane Missiles or Arcane Explosion costs no mana{$?s321758=false}[ and Arcane Missiles fires an additional missile][].
  • description:{$@spelldesc79684=For each ${$c*100/{$s1=200}} mana you spend, you have a 1% chance to gain Clearcasting, making your next Arcane Missiles or Arcane Explosion free and channel {$277726s1=20}% faster.$?a321758[ Arcane Missiles fires {$321758s2=1} additional missile.][]}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Crimson Chorus 5.4 0.0 60.8sec 60.8sec 28.6sec 51.86% 0.00% 0.0 (0.0) 4.9

Buff Details

  • buff initial source:Necrolord_Marileth
  • cooldown name:buff_crimson_chorus
  • max_stacks:3
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:60.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:10.00
  • associated item:Cabalist's Hymnal

Stat Details

  • stat:crit_rating
  • amount:95.00

Trigger Details

  • interval_min/max:60.0s / 65.5s
  • trigger_min/max:60.0s / 65.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • crimson_chorus_1:17.88%
  • crimson_chorus_2:17.28%
  • crimson_chorus_3:16.70%

Spelldata

  • id:344803
  • name:Crimson Chorus
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc344806=Join the Crimson Chorus. Every minute, your Critical Strike swells by ${{$s1=44}*3} over ${{$344803d=10 seconds}*3} sec. before returning to normal. This effect is increased by {$s2=5}% for each member of the Crimson Chorus in your party.}
  • max_stacks:3
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Deathborne 1.9 0.0 253.7sec 253.7sec 19.2sec 11.91% 0.00% 0.0 (0.0) 1.7

Buff Details

  • buff initial source:Necrolord_Marileth
  • cooldown name:buff_deathborne
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:249.2s / 258.3s
  • trigger_min/max:249.2s / 258.3s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 20.0s

Stack Uptimes

  • deathborne_1:11.91%

Spelldata

  • id:324220
  • name:Deathborne
  • tooltip:Transformed into a powerful skeletal mage, greatly enhancing your Frostbolt, Fireball, and Arcane Blast and increasing your spell damage by {$s2=10}%.
  • description:Transform into a powerful skeletal mage for {$d=20 seconds}. While in the form of a skeletal mage, your Frostbolt, Fireball, and Arcane Blast hit up to {$s4=2} enemies near your target and your spell damage is increased by {$s2=10}%.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Evocation 2.0 0.0 185.3sec 185.3sec 3.3sec 2.12% 0.00% 7.8 (7.8) 0.0

Buff Details

  • buff initial source:Necrolord_Marileth
  • cooldown name:buff_evocation
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:7.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:1.00

Trigger Details

  • interval_min/max:90.0s / 304.5s
  • trigger_min/max:90.0s / 304.5s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 4.3s

Stack Uptimes

  • evocation_1:2.12%

Spelldata

  • id:12051
  • name:Evocation
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Gladiator's Badge 2.9 0.0 127.0sec 127.0sec 14.7sec 14.06% 0.00% 0.0 (0.0) 2.7

Buff Details

  • buff initial source:Necrolord_Marileth
  • cooldown name:buff_gladiators_badge
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Sinful Aspirant's Badge of Ferocity

Stat Details

  • stat:intellect
  • amount:342.00

Trigger Details

  • interval_min/max:121.8s / 135.6s
  • trigger_min/max:121.8s / 135.6s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 15.0s

Stack Uptimes

  • gladiators_badge_1:14.06%

Spelldata

  • id:345228
  • name:Gladiator's Badge
  • tooltip:Primary stat increased by $w1.
  • description:Increases primary stat by {$s1=252} for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:0.00%
Potion of Deathly Fixation 1.0 0.0 0.0sec 0.0sec 25.0sec 8.45% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Necrolord_Marileth
  • cooldown name:buff_potion_of_deathly_fixation
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:25.0s / 25.0s

Stack Uptimes

  • potion_of_deathly_fixation_1:8.45%

Spelldata

  • id:307497
  • name:Potion of Deathly Fixation
  • tooltip:Chance to apply Deathly Fixation to your target.
  • description:Your damaging spells and abilities have a chance to apply Deathly Fixation to your target, dealing {$322253s1=43} Shadow damage over {$322253d=8 seconds} and stacking up to 5 times. Upon reaching 5 stacks, Deathly Fixation explodes, dealing {$322256s1=985} Shadow damage to the target. If you consume this potion while your weapon is augmented with Shadowcore Oil, the explosion damage is increased by {$s2=10}%. Lasts {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Presence of Mind 1.8 0.0 243.9sec 243.9sec 5.5sec 3.39% 15.88% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Necrolord_Marileth
  • cooldown name:buff_presence_of_mind
  • max_stacks:3
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:62.8s / 257.6s
  • trigger_min/max:62.8s / 257.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 145.8s

Stack Uptimes

  • presence_of_mind_1:0.58%
  • presence_of_mind_2:0.64%
  • presence_of_mind_3:2.16%

Spelldata

  • id:205025
  • name:Presence of Mind
  • tooltip:Arcane Blast is instant cast.
  • description:Causes your next $n Arcane Blasts to be instant cast.
  • max_stacks:0
  • duration:-0.00
  • cooldown:60.00
  • default_chance:100.00%
Rune of Power 8.9 0.0 34.6sec 34.6sec 11.8sec 35.20% 0.00% 0.0 (0.0) 8.6

Buff Details

  • buff initial source:Necrolord_Marileth
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.8s / 52.4s
  • trigger_min/max:12.8s / 52.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • rune_of_power_1:35.20%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Temporal Warp 1.5 0.0 300.4sec 300.4sec 35.3sec 17.23% 0.00% 0.0 (0.0) 1.1

Buff Details

  • buff initial source:Necrolord_Marileth
  • cooldown name:buff_temporal_warp
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:300.0s / 303.3s
  • trigger_min/max:300.0s / 303.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 40.0s

Stack Uptimes

  • temporal_warp_1:17.23%

Spelldata

  • id:327355
  • name:Temporal Warp
  • tooltip:Haste increased by $w1%.
  • description:{$@spelldesc327351=While you have Temporal Displacement or other similar effects, you may use Time Warp to grant yourself {$327355s1=30}% Haste for {$327355d=40 seconds}.}
  • max_stacks:0
  • duration:40.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism)

Buff Details

  • buff initial source:Necrolord_Marileth
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power

Buff Details

  • buff initial source:Necrolord_Marileth
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Benefit Avg % Min Max
Arcane Barrage Arcane Charge 1 0.05% 0.00% 5.26%
Arcane Barrage Arcane Charge 2 0.20% 0.00% 7.94%
Arcane Barrage Arcane Charge 3 0.35% 0.00% 6.67%
Arcane Barrage Arcane Charge 4 99.40% 85.96% 100.00%
Arcane Blast Arcane Charge 0 4.39% 2.38% 9.30%
Arcane Blast Arcane Charge 1 1.03% 0.00% 10.71%
Arcane Blast Arcane Charge 2 0.84% 0.00% 7.14%
Arcane Blast Arcane Charge 3 0.68% 0.00% 5.71%
Arcane Blast Arcane Charge 4 93.06% 74.29% 97.37%
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 0.37% 0.14% 3.37% 0.6s 0.0s 4.7s
Conserve Phase 100.00% 100.00% 100.00% 299.9s 240.2s 360.0s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.0000.0000.000179.943120.203239.964
Evocation62.2910.000214.526158.31560.555245.322
Rune of Power5.8460.00923.14236.92420.17350.755
Touch of the Magi4.6630.16722.23830.38218.87249.754
Arcane Power5.2811.84615.59615.4365.20120.856
Arcane Barrage3.2990.00022.413173.779134.487210.704
Arcane Orb6.3790.00033.27875.87749.68897.627
Deathborne33.8320.00076.96071.65658.90876.960
Presence of Mind88.2480.406196.063196.25952.511236.092
Time Warp1.0050.0003.2711.4961.2964.571

Burn Phases

Burn phase duration tracks the amount of time spent in each burn phase. This is defined as the time between a start_burn_phase and stop_burn_phase action being executed. Note that "execute" burn phases, i.e., the final burn of a fight, is also included.

Burn Phase Duration
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Mana at burn start is the mana level recorded (in percentage of total mana) when a start_burn_phase command is executed.

Mana at Burn Start
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Necrolord_Marileth
mana_regen Mana 798.80 401563.17 60.54% 502.71 1992.61 0.49%
Evocation Mana 73.41 102647.67 15.47% 1398.27 0.00 0.00%
Mana Gem Mana 2.95 19861.53 2.99% 6736.57 0.00 0.00%
Arcane Barrage Mana 52.00 139267.73 20.99% 2678.19 530.51 0.38%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 66365.7 2211.95 2337.94 2530.7 29573.3 42.8 67365.7
Usage Type Count Total Avg RPE APR
Necrolord_Marileth
arcane_blast Mana 34.2 133762.8 3911.0 3914.9 6.0
arcane_explosion Mana 136.8 537618.0 3930.9 3929.7 1.5
arcane_orb Mana 11.6 5549.3 478.8 478.8 26.7
deathborne Mana 1.9 4692.9 2500.0 2502.0 0.0
time_warp Mana 1.5 2970.8 2000.0 1992.1 0.0
touch_of_the_magi Mana 6.2 15518.7 2500.0 2499.0 14.1

Statistics & Data Analysis

Fight Length
Necrolord_Marileth Fight Length
Count 1319
Mean 299.94
Minimum 240.20
Maximum 359.96
Spread ( max - min ) 119.76
Range [ ( max - min ) / 2 * 100% ] 19.96%
DPS
Necrolord_Marileth Damage Per Second
Count 1319
Mean 9239.42
Minimum 8459.77
Maximum 10196.52
Spread ( max - min ) 1736.76
Range [ ( max - min ) / 2 * 100% ] 9.40%
Standard Deviation 290.1780
5th Percentile 8793.24
95th Percentile 9757.71
( 95th Percentile - 5th Percentile ) 964.48
Mean Distribution
Standard Deviation 7.9899
95.00% Confidence Interval ( 9223.76 - 9255.08 )
Normalized 95.00% Confidence Interval ( 99.83% - 100.17% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 38
0.1% Error 3790
0.1 Scale Factor Error with Delta=300 719
0.05 Scale Factor Error with Delta=300 2876
0.01 Scale Factor Error with Delta=300 71881
Priority Target DPS
Necrolord_Marileth Priority Target Damage Per Second
Count 1319
Mean 4043.93
Minimum 3536.31
Maximum 4608.22
Spread ( max - min ) 1071.91
Range [ ( max - min ) / 2 * 100% ] 13.25%
Standard Deviation 165.8746
5th Percentile 3790.24
95th Percentile 4332.12
( 95th Percentile - 5th Percentile ) 541.88
Mean Distribution
Standard Deviation 4.5673
95.00% Confidence Interval ( 4034.98 - 4052.88 )
Normalized 95.00% Confidence Interval ( 99.78% - 100.22% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 65
0.1% Error 6464
0.1 Scale Factor Error with Delta=300 235
0.05 Scale Factor Error with Delta=300 940
0.01 Scale Factor Error with Delta=300 23488
DPS(e)
Necrolord_Marileth Damage Per Second (Effective)
Count 1319
Mean 9239.42
Minimum 8459.77
Maximum 10196.52
Spread ( max - min ) 1736.76
Range [ ( max - min ) / 2 * 100% ] 9.40%
Damage
Necrolord_Marileth Damage
Count 1319
Mean 2763702.90
Minimum 2099673.93
Maximum 3317522.53
Spread ( max - min ) 1217848.61
Range [ ( max - min ) / 2 * 100% ] 22.03%
DTPS
Necrolord_Marileth Damage Taken Per Second
Count 1319
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Necrolord_Marileth Healing Per Second
Count 1319
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Necrolord_Marileth Healing Per Second (Effective)
Count 1319
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Necrolord_Marileth Heal
Count 1319
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Necrolord_Marileth Healing Taken Per Second
Count 1319
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Necrolord_Marileth Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Necrolord_MarilethTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Necrolord_Marileth Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 variable,name=prepull_evo,op=reset,default=0
1 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
2 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
3 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
4 0.00 variable,name=have_opened,op=reset,default=0
5 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
6 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
7 0.00 variable,name=final_burn,op=set,value=0
8 0.00 variable,name=rs_max_delay,op=reset,default=5
9 0.00 variable,name=ap_max_delay,op=reset,default=10
A 0.00 variable,name=rop_max_delay,op=reset,default=20
B 0.00 variable,name=totm_max_delay,op=reset,default=5
C 0.00 variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
D 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
E 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
F 0.00 variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
G 0.00 variable,name=barrage_mana_pct,op=reset,default=70
H 0.00 variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
I 0.00 variable,name=ap_minimum_mana_pct,op=reset,default=30
J 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
K 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
L 0.00 variable,name=totm_max_charges,op=reset,default=2
M 0.00 variable,name=aoe_totm_max_charges,op=reset,default=2
N 0.00 variable,name=am_spam,op=reset,default=0
O 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
P 0.00 variable,name=am_spam_evo_pct,op=reset,default=15
Q 0.00 flask
R 0.00 food
S 0.00 augmentation
T 0.00 arcane_familiar
U 0.00 arcane_intellect
V 0.00 conjure_mana_gem
W 0.00 snapshot_stats
X 0.00 mirror_image
Y 0.00 frostbolt,if=variable.prepull_evo<=0
Z 0.00 evocation,if=variable.prepull_evo>0
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
a 0.00 call_action_list,name=shared_cds
b 0.00 call_action_list,name=essences
c 0.00 call_action_list,name=aoe,if=active_enemies>2
d 0.00 call_action_list,name=opener,if=variable.have_opened<=0
e 0.00 call_action_list,name=am_spam,if=variable.am_spam=1
f 0.00 call_action_list,name=cooldowns
g 0.00 call_action_list,name=rotation,if=variable.final_burn=0
h 0.00 call_action_list,name=final_burn,if=variable.final_burn=1
i 0.00 call_action_list,name=movement
actions.aoe
# count action,conditions
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
0.00 arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
0.00 mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
j 1.89 deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
k 6.23 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
l 2.87 arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
m 6.10 rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
n 1.80 presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
o 34.17 arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
0.00 supernova
p 11.54 arcane_orb,if=buff.arcane_charge.stack=0
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
q 136.77 arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
0.00 arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
r 51.68 arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
s 1.96 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.cooldowns
# count action,conditions
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
Prioritize using grisly icicle with ap. Use it with totm otherwise.
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
0.00 mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
0.00 mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
0.00 deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
0.00 deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
0.00 radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
0.00 touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
0.00 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
0.00 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
0.00 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
0.00 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
0.00 arcane_power,if=(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
0.00 rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
0.00 presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
t 0.05 presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled
Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.rotation
# count action,conditions
0.00 variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
0.00 arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
u 0.01 arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
0.00 arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
0.00 arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
0.00 strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
0.00 arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
0.00 arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
v 0.00 arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
0.00 arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
0.00 arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
0.00 arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
0.00 arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
0.00 arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
w 0.04 arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
0.00 supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
0.00 arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
0.00 arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
0.00 arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
0.00 arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
x 0.15 arcane_blast
0.00 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
y 0.31 arcane_barrage
actions.shared_cds
# count action,conditions
z 2.95 use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
{ 2.87 use_items,if=buff.arcane_power.up
| 1.00 potion,if=buff.arcane_power.up
} 1.49 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
0.00 lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
~ 1.87 berserking,if=buff.arcane_power.up
0.00 blood_fury,if=buff.arcane_power.up
0.00 fireblood,if=buff.arcane_power.up
0.00 ancestral_call,if=buff.arcane_power.up

Sample Sequence

045789ABGILMNPQRVXYj}kl{|~oozoooooonoooooooomooooooroqqqrprqqqqrqsqqqrqqqqrqqqqrprqqqqrqqqqrkmrqqqqrprqqqqrqqqqrqqqqrprqqqqrqqqqrkmrqqqqrprqzqqql{rqqqqrqqqqrprqqqqrqqqqrkmrqqqqrprqqqqrqqqqrqqqqrprqqqqrqqqsqrkmrprqqqqrqqqqrqqqqrprqqqqzrqqqqrqqqqrjkl{~oooonooooooomoooorprqqqqrqqqqrqqq}sqrprqqqqrqqqqrqkmrqqqqrprqqqqrqqqqrqqqqrqqqq

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 prepull_evo Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat 4 have_opened Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat 5 have_opened Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat 7 final_burn Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat 8 rs_max_delay Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat 9 ap_max_delay Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat A rop_max_delay Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat B totm_max_delay Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat G barrage_mana_pct Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat I ap_minimum_mana_pct Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat L totm_max_charges Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat M aoe_totm_max_charges Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat N am_spam Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat P am_spam_evo_pct Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat Q flask Necrolord_Marileth 67365.7/67366: 100% mana
Pre precombat R food Necrolord_Marileth 67365.7/67366: 100% mana
Pre precombat V conjure_mana_gem Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat X mirror_image Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat Y frostbolt Fluffy_Pillow 67365.7/67366: 100% mana
0:00.000 aoe j deathborne Fluffy_Pillow 66365.7/67366: 99% mana
0:01.300 shared_cds } time_warp Fluffy_Pillow 64872.5/67366: 96% mana bloodlust, deathborne, crimson_chorus
0:01.300 aoe k touch_of_the_magi Fluffy_Pillow 62872.5/67366: 93% mana bloodlust, temporal_warp, deathborne, crimson_chorus
0:02.070 aoe l arcane_power Fluffy_Pillow 61409.9/67366: 91% mana bloodlust, arcane_charge(4), temporal_warp, deathborne, crimson_chorus
0:02.070 shared_cds { use_items Fluffy_Pillow 61409.9/67366: 91% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, deathborne, crimson_chorus
0:02.070 shared_cds | potion Fluffy_Pillow 61409.9/67366: 91% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, deathborne, crimson_chorus, gladiators_badge
0:02.070 shared_cds ~ berserking Fluffy_Pillow 61409.9/67366: 91% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, deathborne, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:02.070 aoe o arcane_blast Fluffy_Pillow 61409.9/67366: 91% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, deathborne, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:02.823 aoe o arcane_blast Fluffy_Pillow 58986.9/67366: 88% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, deathborne, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:03.580 shared_cds z use_mana_gem Necrolord_Marileth 56569.3/67366: 84% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, deathborne, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:03.580 aoe o arcane_blast Fluffy_Pillow 63305.9/67366: 94% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, deathborne, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:04.333 aoe o arcane_blast Fluffy_Pillow 60882.9/67366: 90% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, deathborne, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:05.088 aoe o arcane_blast Fluffy_Pillow 58462.6/67366: 87% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, deathborne, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:05.842 aoe o arcane_blast Fluffy_Pillow 56041.0/67366: 83% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, deathborne, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:06.597 aoe o arcane_blast Fluffy_Pillow 53620.7/67366: 80% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, deathborne, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:07.351 aoe o arcane_blast Fluffy_Pillow 51199.1/67366: 76% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, deathborne, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:08.104 aoe n presence_of_mind Fluffy_Pillow 48776.1/67366: 72% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, deathborne, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:08.104 aoe o arcane_blast Fluffy_Pillow 48776.1/67366: 72% mana bloodlust, berserking, arcane_charge(4), arcane_power, presence_of_mind(3), rune_of_power, temporal_warp, deathborne, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:08.857 aoe o arcane_blast Fluffy_Pillow 46353.2/67366: 69% mana bloodlust, berserking, arcane_charge(4), arcane_power, presence_of_mind(2), rune_of_power, temporal_warp, deathborne, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:09.613 aoe o arcane_blast Fluffy_Pillow 43934.2/67366: 65% mana bloodlust, berserking, arcane_charge(4), arcane_power, presence_of_mind, rune_of_power, temporal_warp, deathborne, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:10.366 aoe o arcane_blast Fluffy_Pillow 41511.3/67366: 62% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, deathborne, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:11.122 aoe o arcane_blast Fluffy_Pillow 39092.3/67366: 58% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, deathborne, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:11.877 aoe o arcane_blast Fluffy_Pillow 36672.1/67366: 54% mana bloodlust, berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, temporal_warp, deathborne, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:12.631 aoe o arcane_blast Fluffy_Pillow 34250.4/67366: 51% mana bloodlust, berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, temporal_warp, deathborne, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:13.385 aoe o arcane_blast Fluffy_Pillow 31828.8/67366: 47% mana bloodlust, berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, temporal_warp, deathborne, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:14.140 aoe m rune_of_power Fluffy_Pillow 29408.5/67366: 44% mana bloodlust, arcane_charge(4), arcane_power, clearcasting, temporal_warp, deathborne, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:14.912 aoe o arcane_blast Fluffy_Pillow 30448.7/67366: 45% mana bloodlust, arcane_charge(4), arcane_power, clearcasting, rune_of_power, temporal_warp, deathborne, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:15.698 aoe o arcane_blast Fluffy_Pillow 28070.2/67366: 42% mana bloodlust, arcane_charge(4), arcane_power, clearcasting, rune_of_power, temporal_warp, deathborne, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:16.482 aoe o arcane_blast Fluffy_Pillow 25688.9/67366: 38% mana bloodlust, arcane_charge(4), arcane_power, clearcasting, rune_of_power, temporal_warp, deathborne, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:17.268 aoe o arcane_blast Fluffy_Pillow 19872.9/67366: 30% mana bloodlust, arcane_charge(4), clearcasting, rune_of_power, temporal_warp, deathborne, crimson_chorus(2), potion_of_deathly_fixation
0:18.054 aoe o arcane_blast Fluffy_Pillow 14056.9/67366: 21% mana bloodlust, arcane_charge(4), clearcasting, rune_of_power, temporal_warp, deathborne, crimson_chorus(2), potion_of_deathly_fixation
0:18.839 aoe o arcane_blast Fluffy_Pillow 8239.6/67366: 12% mana bloodlust, arcane_charge(4), clearcasting(2), rune_of_power, temporal_warp, deathborne, crimson_chorus(2), potion_of_deathly_fixation
0:19.624 aoe r arcane_barrage Fluffy_Pillow 2422.2/67366: 4% mana bloodlust, arcane_charge(4), clearcasting(2), rune_of_power, temporal_warp, deathborne, crimson_chorus(2), potion_of_deathly_fixation
0:20.395 aoe o arcane_blast Fluffy_Pillow 6155.6/67366: 9% mana bloodlust, clearcasting(2), rune_of_power, temporal_warp, deathborne, crimson_chorus(3), potion_of_deathly_fixation
0:21.551 aoe q arcane_explosion Fluffy_Pillow 6338.1/67366: 9% mana bloodlust, arcane_charge, clearcasting(2), rune_of_power, temporal_warp, crimson_chorus(3), potion_of_deathly_fixation
0:22.321 aoe q arcane_explosion Fluffy_Pillow 7375.5/67366: 11% mana bloodlust, arcane_charge(2), clearcasting, rune_of_power, temporal_warp, crimson_chorus(3), potion_of_deathly_fixation
0:23.092 aoe q arcane_explosion Fluffy_Pillow 8414.3/67366: 12% mana bloodlust, arcane_charge(3), rune_of_power, temporal_warp, crimson_chorus(3), potion_of_deathly_fixation
0:23.862 aoe r arcane_barrage Fluffy_Pillow 4451.8/67366: 7% mana bloodlust, arcane_charge(4), rune_of_power, temporal_warp, crimson_chorus(3), potion_of_deathly_fixation
0:24.632 aoe p arcane_orb Fluffy_Pillow 8183.8/67366: 12% mana bloodlust, rune_of_power, temporal_warp, crimson_chorus(3), potion_of_deathly_fixation
0:25.403 aoe r arcane_barrage Fluffy_Pillow 8722.6/67366: 13% mana bloodlust, arcane_charge(4), rune_of_power, temporal_warp, crimson_chorus(3), potion_of_deathly_fixation
0:26.172 aoe q arcane_explosion Fluffy_Pillow 12453.3/67366: 18% mana bloodlust, rune_of_power, temporal_warp, crimson_chorus(3), potion_of_deathly_fixation
0:26.943 aoe q arcane_explosion Fluffy_Pillow 8492.1/67366: 13% mana bloodlust, arcane_charge, clearcasting, temporal_warp, crimson_chorus(3), potion_of_deathly_fixation
0:27.713 aoe q arcane_explosion Fluffy_Pillow 9529.5/67366: 14% mana bloodlust, arcane_charge(2), temporal_warp, crimson_chorus(3)
0:28.485 aoe q arcane_explosion Fluffy_Pillow 5569.6/67366: 8% mana bloodlust, arcane_charge(3), temporal_warp, crimson_chorus(3)
0:29.254 aoe r arcane_barrage Fluffy_Pillow 1605.7/67366: 2% mana bloodlust, arcane_charge(4), temporal_warp, crimson_chorus(3)
0:30.023 aoe q arcane_explosion Fluffy_Pillow 5336.4/67366: 8% mana bloodlust, temporal_warp, crimson_chorus(3)
0:30.793 aoe s evocation Necrolord_Marileth 1373.9/67366: 2% mana bloodlust, arcane_charge, temporal_warp
0:33.355 aoe q arcane_explosion Fluffy_Pillow 58625.3/67366: 87% mana bloodlust, arcane_charge, temporal_warp
0:34.126 aoe q arcane_explosion Fluffy_Pillow 54664.1/67366: 81% mana bloodlust, arcane_charge(2), temporal_warp
0:34.897 aoe q arcane_explosion Fluffy_Pillow 50702.9/67366: 75% mana bloodlust, arcane_charge(3), temporal_warp
0:35.666 aoe r arcane_barrage Fluffy_Pillow 46739.0/67366: 69% mana bloodlust, arcane_charge(4), temporal_warp
0:36.436 aoe q arcane_explosion Fluffy_Pillow 50471.0/67366: 75% mana bloodlust, temporal_warp
0:37.207 aoe q arcane_explosion Fluffy_Pillow 46509.8/67366: 69% mana bloodlust, arcane_charge, temporal_warp
0:37.976 aoe q arcane_explosion Fluffy_Pillow 42545.9/67366: 63% mana bloodlust, arcane_charge(2), temporal_warp
0:38.746 aoe q arcane_explosion Fluffy_Pillow 38583.3/67366: 57% mana bloodlust, arcane_charge(3), clearcasting, temporal_warp
0:39.518 aoe r arcane_barrage Fluffy_Pillow 39623.4/67366: 59% mana bloodlust, arcane_charge(4), temporal_warp
0:40.289 aoe q arcane_explosion Fluffy_Pillow 43356.9/67366: 64% mana bloodlust, temporal_warp
0:41.060 aoe q arcane_explosion Fluffy_Pillow 39395.6/67366: 58% mana arcane_charge, temporal_warp
0:42.060 aoe q arcane_explosion Fluffy_Pillow 35742.9/67366: 53% mana arcane_charge(2)
0:43.361 aoe q arcane_explosion Fluffy_Pillow 32495.8/67366: 48% mana arcane_charge(3)
0:44.661 aoe r arcane_barrage Fluffy_Pillow 29247.3/67366: 43% mana arcane_charge(4)
0:45.961 aoe p arcane_orb Fluffy_Pillow 33693.4/67366: 50% mana
0:47.261 aoe r arcane_barrage Fluffy_Pillow 34945.0/67366: 52% mana arcane_charge(4)
0:48.560 aoe q arcane_explosion Fluffy_Pillow 39389.7/67366: 58% mana
0:49.860 aoe q arcane_explosion Fluffy_Pillow 36141.3/67366: 54% mana arcane_charge
0:51.159 aoe q arcane_explosion Fluffy_Pillow 32891.4/67366: 49% mana arcane_charge(2), clearcasting
0:52.459 aoe q arcane_explosion Fluffy_Pillow 34642.9/67366: 51% mana arcane_charge(3)
0:53.758 aoe r arcane_barrage Fluffy_Pillow 31393.1/67366: 47% mana arcane_charge(4), clearcasting
0:55.057 aoe q arcane_explosion Fluffy_Pillow 35837.9/67366: 53% mana clearcasting
0:56.356 aoe q arcane_explosion Fluffy_Pillow 37588.0/67366: 56% mana arcane_charge
0:57.656 aoe q arcane_explosion Fluffy_Pillow 34339.5/67366: 51% mana arcane_charge(2)
0:58.956 aoe q arcane_explosion Fluffy_Pillow 31091.1/67366: 46% mana arcane_charge(3)
1:00.256 aoe r arcane_barrage Fluffy_Pillow 27842.6/67366: 41% mana arcane_charge(4), clearcasting
1:01.556 aoe k touch_of_the_magi Fluffy_Pillow 32288.7/67366: 48% mana clearcasting, crimson_chorus
1:02.855 aoe m rune_of_power Fluffy_Pillow 31538.9/67366: 47% mana arcane_charge(4), clearcasting, crimson_chorus
1:04.154 aoe r arcane_barrage Fluffy_Pillow 33289.0/67366: 49% mana arcane_charge(4), clearcasting, rune_of_power, crimson_chorus
1:05.453 aoe q arcane_explosion Fluffy_Pillow 37733.8/67366: 56% mana clearcasting, rune_of_power, crimson_chorus
1:06.751 aoe q arcane_explosion Fluffy_Pillow 39482.6/67366: 59% mana arcane_charge, rune_of_power, crimson_chorus
1:08.050 aoe q arcane_explosion Fluffy_Pillow 36232.8/67366: 54% mana arcane_charge(2), rune_of_power, crimson_chorus
1:09.349 aoe q arcane_explosion Fluffy_Pillow 32982.9/67366: 49% mana arcane_charge(3), rune_of_power, crimson_chorus
1:10.649 aoe r arcane_barrage Fluffy_Pillow 29734.5/67366: 44% mana arcane_charge(4), rune_of_power, crimson_chorus
1:11.948 aoe p arcane_orb Fluffy_Pillow 34179.2/67366: 51% mana rune_of_power, crimson_chorus(2)
1:13.248 aoe r arcane_barrage Fluffy_Pillow 35430.8/67366: 53% mana arcane_charge(4), rune_of_power, crimson_chorus(2)
1:14.548 aoe q arcane_explosion Fluffy_Pillow 39876.9/67366: 59% mana rune_of_power, crimson_chorus(2)
1:15.847 aoe q arcane_explosion Fluffy_Pillow 36627.1/67366: 54% mana arcane_charge, rune_of_power, crimson_chorus(2)
1:17.145 aoe q arcane_explosion Fluffy_Pillow 33375.9/67366: 50% mana arcane_charge(2), crimson_chorus(2)
1:18.443 aoe q arcane_explosion Fluffy_Pillow 30124.7/67366: 45% mana arcane_charge(3), crimson_chorus(2)
1:19.744 aoe r arcane_barrage Fluffy_Pillow 26877.5/67366: 40% mana arcane_charge(4), crimson_chorus(2)
1:21.044 aoe q arcane_explosion Fluffy_Pillow 31323.7/67366: 46% mana crimson_chorus(3)
1:22.344 aoe q arcane_explosion Fluffy_Pillow 28075.2/67366: 42% mana arcane_charge, crimson_chorus(3)
1:23.643 aoe q arcane_explosion Fluffy_Pillow 24825.3/67366: 37% mana arcane_charge(2), crimson_chorus(3)
1:24.941 aoe q arcane_explosion Fluffy_Pillow 21574.2/67366: 32% mana arcane_charge(3), crimson_chorus(3)
1:26.239 aoe r arcane_barrage Fluffy_Pillow 18323.0/67366: 27% mana arcane_charge(4), crimson_chorus(3)
1:27.538 aoe q arcane_explosion Fluffy_Pillow 22767.8/67366: 34% mana crimson_chorus(3)
1:28.839 aoe q arcane_explosion Fluffy_Pillow 19520.6/67366: 29% mana arcane_charge, crimson_chorus(3)
1:30.139 aoe q arcane_explosion Fluffy_Pillow 16272.1/67366: 24% mana arcane_charge(2), crimson_chorus(3)
1:31.439 aoe q arcane_explosion Fluffy_Pillow 13023.6/67366: 19% mana arcane_charge(3), clearcasting
1:32.738 aoe r arcane_barrage Fluffy_Pillow 14773.8/67366: 22% mana arcane_charge(4)
1:34.038 aoe p arcane_orb Fluffy_Pillow 19219.9/67366: 29% mana
1:35.338 aoe r arcane_barrage Fluffy_Pillow 20471.4/67366: 30% mana arcane_charge(4)
1:36.638 aoe q arcane_explosion Fluffy_Pillow 24917.6/67366: 37% mana
1:37.938 aoe q arcane_explosion Fluffy_Pillow 21669.1/67366: 32% mana arcane_charge
1:39.236 aoe q arcane_explosion Fluffy_Pillow 18417.9/67366: 27% mana arcane_charge(2), clearcasting
1:40.535 aoe q arcane_explosion Fluffy_Pillow 20168.1/67366: 30% mana arcane_charge(3)
1:41.834 aoe r arcane_barrage Fluffy_Pillow 16918.2/67366: 25% mana arcane_charge(4)
1:43.134 aoe q arcane_explosion Fluffy_Pillow 21364.4/67366: 32% mana
1:44.433 aoe q arcane_explosion Fluffy_Pillow 18114.5/67366: 27% mana arcane_charge
1:45.731 aoe q arcane_explosion Fluffy_Pillow 14863.3/67366: 22% mana arcane_charge(2), clearcasting
1:47.030 aoe q arcane_explosion Fluffy_Pillow 16613.5/67366: 25% mana arcane_charge(3)
1:48.330 aoe r arcane_barrage Fluffy_Pillow 13365.0/67366: 20% mana arcane_charge(4)
1:49.630 aoe k touch_of_the_magi Fluffy_Pillow 17811.1/67366: 26% mana
1:50.930 aoe m rune_of_power Fluffy_Pillow 17062.7/67366: 25% mana arcane_charge(4)
1:52.228 aoe r arcane_barrage Fluffy_Pillow 18811.5/67366: 28% mana arcane_charge(4), rune_of_power
1:53.527 aoe q arcane_explosion Fluffy_Pillow 23256.3/67366: 35% mana rune_of_power
1:54.825 aoe q arcane_explosion Fluffy_Pillow 20005.1/67366: 30% mana arcane_charge, rune_of_power
1:56.124 aoe q arcane_explosion Fluffy_Pillow 16755.2/67366: 25% mana arcane_charge(2), rune_of_power
1:57.424 aoe q arcane_explosion Fluffy_Pillow 13506.7/67366: 20% mana arcane_charge(3), clearcasting, rune_of_power
1:58.722 aoe r arcane_barrage Fluffy_Pillow 15255.6/67366: 23% mana arcane_charge(4), rune_of_power
2:00.021 aoe p arcane_orb Fluffy_Pillow 19700.3/67366: 29% mana rune_of_power
2:01.320 aoe r arcane_barrage Fluffy_Pillow 20950.5/67366: 31% mana arcane_charge(4), rune_of_power
2:02.619 aoe q arcane_explosion Fluffy_Pillow 25395.3/67366: 38% mana rune_of_power, crimson_chorus
2:03.918 shared_cds z use_mana_gem Necrolord_Marileth 22145.5/67366: 33% mana arcane_charge, rune_of_power, crimson_chorus
2:03.918 aoe q arcane_explosion Fluffy_Pillow 28882.0/67366: 43% mana arcane_charge, rune_of_power, crimson_chorus
2:05.218 aoe q arcane_explosion Fluffy_Pillow 25633.5/67366: 38% mana arcane_charge(2), clearcasting, crimson_chorus
2:06.518 aoe q arcane_explosion Fluffy_Pillow 27385.0/67366: 41% mana arcane_charge(3), crimson_chorus
2:07.818 aoe l arcane_power Fluffy_Pillow 24136.6/67366: 36% mana arcane_charge(4), crimson_chorus
2:07.818 shared_cds { use_items Fluffy_Pillow 24136.6/67366: 36% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus
2:07.818 aoe r arcane_barrage Fluffy_Pillow 24136.6/67366: 36% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus, gladiators_badge
2:09.119 aoe q arcane_explosion Fluffy_Pillow 28584.0/67366: 42% mana arcane_power, rune_of_power, crimson_chorus, gladiators_badge
2:10.420 aoe q arcane_explosion Fluffy_Pillow 27836.9/67366: 41% mana arcane_charge, arcane_power, rune_of_power, crimson_chorus, gladiators_badge
2:11.719 aoe q arcane_explosion Fluffy_Pillow 27087.1/67366: 40% mana arcane_charge(2), arcane_power, rune_of_power, crimson_chorus, gladiators_badge
2:13.019 aoe q arcane_explosion Fluffy_Pillow 26338.6/67366: 39% mana arcane_charge(3), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:14.319 aoe r arcane_barrage Fluffy_Pillow 25590.1/67366: 38% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:15.620 aoe q arcane_explosion Fluffy_Pillow 30037.6/67366: 45% mana arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:16.919 aoe q arcane_explosion Fluffy_Pillow 29287.7/67366: 43% mana arcane_charge, arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:18.218 aoe q arcane_explosion Fluffy_Pillow 28537.9/67366: 42% mana arcane_charge(2), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:19.517 aoe q arcane_explosion Fluffy_Pillow 27788.0/67366: 41% mana arcane_charge(3), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:20.816 aoe r arcane_barrage Fluffy_Pillow 27038.2/67366: 40% mana arcane_charge(4), arcane_power, crimson_chorus(2), gladiators_badge
2:22.115 aoe p arcane_orb Fluffy_Pillow 31483.0/67366: 47% mana arcane_power, crimson_chorus(3), gladiators_badge
2:23.414 aoe r arcane_barrage Fluffy_Pillow 32983.2/67366: 49% mana arcane_charge(4), crimson_chorus(3)
2:24.714 aoe q arcane_explosion Fluffy_Pillow 37429.3/67366: 56% mana crimson_chorus(3)
2:26.014 aoe q arcane_explosion Fluffy_Pillow 34180.8/67366: 51% mana arcane_charge, crimson_chorus(3)
2:27.314 aoe q arcane_explosion Fluffy_Pillow 30932.3/67366: 46% mana arcane_charge(2), crimson_chorus(3)
2:28.614 aoe q arcane_explosion Fluffy_Pillow 27683.8/67366: 41% mana arcane_charge(3), crimson_chorus(3)
2:29.914 aoe r arcane_barrage Fluffy_Pillow 24435.3/67366: 36% mana arcane_charge(4), crimson_chorus(3)
2:31.215 aoe q arcane_explosion Fluffy_Pillow 28882.8/67366: 43% mana crimson_chorus(3)
2:32.513 aoe q arcane_explosion Fluffy_Pillow 25631.6/67366: 38% mana arcane_charge
2:33.813 aoe q arcane_explosion Fluffy_Pillow 22383.1/67366: 33% mana arcane_charge(2)
2:35.112 aoe q arcane_explosion Fluffy_Pillow 19133.3/67366: 28% mana arcane_charge(3)
2:36.410 aoe r arcane_barrage Fluffy_Pillow 15882.1/67366: 24% mana arcane_charge(4)
2:37.710 aoe k touch_of_the_magi Fluffy_Pillow 20328.2/67366: 30% mana
2:39.009 aoe m rune_of_power Fluffy_Pillow 19578.4/67366: 29% mana arcane_charge(4)
2:40.308 aoe r arcane_barrage Fluffy_Pillow 21328.6/67366: 32% mana arcane_charge(4), rune_of_power
2:41.606 aoe q arcane_explosion Fluffy_Pillow 25772.0/67366: 38% mana rune_of_power
2:42.906 aoe q arcane_explosion Fluffy_Pillow 22523.5/67366: 33% mana arcane_charge, rune_of_power
2:44.206 aoe q arcane_explosion Fluffy_Pillow 19275.0/67366: 29% mana arcane_charge(2), clearcasting, rune_of_power
2:45.504 aoe q arcane_explosion Fluffy_Pillow 21023.8/67366: 31% mana arcane_charge(3), rune_of_power
2:46.803 aoe r arcane_barrage Fluffy_Pillow 17774.0/67366: 26% mana arcane_charge(4), rune_of_power
2:48.102 aoe p arcane_orb Fluffy_Pillow 22218.8/67366: 33% mana rune_of_power
2:49.401 aoe r arcane_barrage Fluffy_Pillow 23469.0/67366: 35% mana arcane_charge(4), rune_of_power
2:50.702 aoe q arcane_explosion Fluffy_Pillow 27916.4/67366: 41% mana rune_of_power
2:52.001 aoe q arcane_explosion Fluffy_Pillow 24666.6/67366: 37% mana arcane_charge, clearcasting, rune_of_power
2:53.301 aoe q arcane_explosion Fluffy_Pillow 26418.1/67366: 39% mana arcane_charge(2)
2:54.600 aoe q arcane_explosion Fluffy_Pillow 23168.3/67366: 34% mana arcane_charge(3)
2:55.899 aoe r arcane_barrage Fluffy_Pillow 19918.4/67366: 30% mana arcane_charge(4)
2:57.199 aoe q arcane_explosion Fluffy_Pillow 24364.6/67366: 36% mana
2:58.499 aoe q arcane_explosion Fluffy_Pillow 21116.1/67366: 31% mana arcane_charge
2:59.799 aoe q arcane_explosion Fluffy_Pillow 17867.6/67366: 27% mana arcane_charge(2), clearcasting
3:01.099 aoe q arcane_explosion Fluffy_Pillow 19619.1/67366: 29% mana arcane_charge(3)
3:02.399 aoe r arcane_barrage Fluffy_Pillow 16370.6/67366: 24% mana arcane_charge(4)
3:03.699 aoe q arcane_explosion Fluffy_Pillow 20816.7/67366: 31% mana crimson_chorus
3:05.000 aoe q arcane_explosion Fluffy_Pillow 17569.6/67366: 26% mana arcane_charge, crimson_chorus
3:06.299 aoe q arcane_explosion Fluffy_Pillow 14319.8/67366: 21% mana arcane_charge(2), crimson_chorus
3:07.599 aoe q arcane_explosion Fluffy_Pillow 11071.3/67366: 16% mana arcane_charge(3), crimson_chorus
3:08.899 aoe r arcane_barrage Fluffy_Pillow 7822.8/67366: 12% mana arcane_charge(4), crimson_chorus
3:10.198 aoe p arcane_orb Fluffy_Pillow 12267.6/67366: 18% mana crimson_chorus
3:11.498 aoe r arcane_barrage Fluffy_Pillow 13519.1/67366: 20% mana arcane_charge(4), crimson_chorus
3:12.798 aoe q arcane_explosion Fluffy_Pillow 17965.2/67366: 27% mana crimson_chorus
3:14.096 aoe q arcane_explosion Fluffy_Pillow 14714.0/67366: 22% mana arcane_charge, crimson_chorus(2)
3:15.394 aoe q arcane_explosion Fluffy_Pillow 11462.8/67366: 17% mana arcane_charge(2), crimson_chorus(2)
3:16.695 aoe q arcane_explosion Fluffy_Pillow 8215.7/67366: 12% mana arcane_charge(3), crimson_chorus(2)
3:17.995 aoe r arcane_barrage Fluffy_Pillow 4967.2/67366: 7% mana arcane_charge(4), crimson_chorus(2)
3:19.295 aoe q arcane_explosion Fluffy_Pillow 9413.3/67366: 14% mana crimson_chorus(2)
3:20.594 aoe q arcane_explosion Fluffy_Pillow 6163.5/67366: 9% mana arcane_charge, clearcasting, crimson_chorus(2)
3:21.894 aoe q arcane_explosion Fluffy_Pillow 7915.0/67366: 12% mana arcane_charge(2), crimson_chorus(2)
3:23.194 aoe s evocation Fluffy_Pillow 4666.5/67366: 7% mana arcane_charge(3), crimson_chorus(3)
3:27.515 aoe q arcane_explosion Fluffy_Pillow 61877.5/67366: 92% mana arcane_charge(3), crimson_chorus(3)
3:28.814 aoe r arcane_barrage Fluffy_Pillow 58627.7/67366: 87% mana arcane_charge(4), crimson_chorus(3)
3:30.114 aoe k touch_of_the_magi Fluffy_Pillow 63073.8/67366: 94% mana crimson_chorus(3)
3:31.414 aoe m rune_of_power Fluffy_Pillow 62325.3/67366: 93% mana arcane_charge(4), crimson_chorus(3)
3:32.714 aoe r arcane_barrage Fluffy_Pillow 64076.8/67366: 95% mana arcane_charge(4), rune_of_power, crimson_chorus(3)
3:34.013 aoe p arcane_orb Fluffy_Pillow 67365.7/67366: 100% mana rune_of_power
3:35.311 aoe r arcane_barrage Fluffy_Pillow 67365.7/67366: 100% mana arcane_charge(4), rune_of_power
3:36.609 aoe q arcane_explosion Fluffy_Pillow 67365.7/67366: 100% mana rune_of_power
3:37.911 aoe q arcane_explosion Fluffy_Pillow 64119.9/67366: 95% mana arcane_charge, rune_of_power
3:39.211 aoe q arcane_explosion Fluffy_Pillow 60871.4/67366: 90% mana arcane_charge(2), rune_of_power
3:40.510 aoe q arcane_explosion Fluffy_Pillow 57621.6/67366: 86% mana arcane_charge(3), rune_of_power
3:41.809 aoe r arcane_barrage Fluffy_Pillow 54371.7/67366: 81% mana arcane_charge(4), clearcasting, rune_of_power
3:43.109 aoe q arcane_explosion Fluffy_Pillow 58817.9/67366: 87% mana clearcasting, rune_of_power
3:44.409 aoe q arcane_explosion Fluffy_Pillow 60569.4/67366: 90% mana arcane_charge, rune_of_power
3:45.708 aoe q arcane_explosion Fluffy_Pillow 57319.6/67366: 85% mana arcane_charge(2)
3:47.006 aoe q arcane_explosion Fluffy_Pillow 54068.4/67366: 80% mana arcane_charge(3)
3:48.305 aoe r arcane_barrage Fluffy_Pillow 50818.5/67366: 75% mana arcane_charge(4)
3:49.606 aoe q arcane_explosion Fluffy_Pillow 55266.0/67366: 82% mana
3:50.904 aoe q arcane_explosion Fluffy_Pillow 52014.8/67366: 77% mana arcane_charge, clearcasting
3:52.202 aoe q arcane_explosion Fluffy_Pillow 53763.6/67366: 80% mana arcane_charge(2)
3:53.499 aoe q arcane_explosion Fluffy_Pillow 50511.1/67366: 75% mana arcane_charge(3)
3:54.798 aoe r arcane_barrage Fluffy_Pillow 47261.3/67366: 70% mana arcane_charge(4)
3:56.097 aoe p arcane_orb Fluffy_Pillow 51706.1/67366: 77% mana
3:57.398 aoe r arcane_barrage Fluffy_Pillow 52958.9/67366: 79% mana arcane_charge(4)
3:58.697 aoe q arcane_explosion Fluffy_Pillow 57403.7/67366: 85% mana
3:59.997 aoe q arcane_explosion Fluffy_Pillow 54155.2/67366: 80% mana arcane_charge
4:01.296 aoe q arcane_explosion Fluffy_Pillow 50905.4/67366: 76% mana arcane_charge(2)
4:02.597 aoe q arcane_explosion Fluffy_Pillow 47658.2/67366: 71% mana arcane_charge(3)
4:03.897 shared_cds z use_mana_gem Necrolord_Marileth 44409.7/67366: 66% mana arcane_charge(4)
4:03.918 aoe r arcane_barrage Fluffy_Pillow 51174.6/67366: 76% mana arcane_charge(4)
4:05.217 aoe q arcane_explosion Fluffy_Pillow 55619.4/67366: 83% mana crimson_chorus
4:06.515 aoe q arcane_explosion Fluffy_Pillow 52368.2/67366: 78% mana arcane_charge, clearcasting, crimson_chorus
4:07.813 aoe q arcane_explosion Fluffy_Pillow 54117.0/67366: 80% mana arcane_charge(2), crimson_chorus
4:09.112 aoe q arcane_explosion Fluffy_Pillow 50867.2/67366: 76% mana arcane_charge(3), crimson_chorus
4:10.411 aoe r arcane_barrage Fluffy_Pillow 47617.3/67366: 71% mana arcane_charge(4), clearcasting, crimson_chorus
4:11.711 aoe q arcane_explosion Fluffy_Pillow 52063.5/67366: 77% mana clearcasting, crimson_chorus
4:13.012 aoe q arcane_explosion Fluffy_Pillow 53816.3/67366: 80% mana arcane_charge, crimson_chorus
4:14.310 aoe q arcane_explosion Fluffy_Pillow 50565.2/67366: 75% mana arcane_charge(2), crimson_chorus
4:15.608 aoe q arcane_explosion Fluffy_Pillow 47314.0/67366: 70% mana arcane_charge(3), crimson_chorus(2)
4:16.908 aoe r arcane_barrage Fluffy_Pillow 44065.5/67366: 65% mana arcane_charge(4), crimson_chorus(2)
4:18.207 aoe j deathborne Fluffy_Pillow 48510.3/67366: 72% mana crimson_chorus(2)
4:19.505 aoe k touch_of_the_magi Fluffy_Pillow 47759.1/67366: 71% mana deathborne, crimson_chorus(2)
4:20.802 aoe l arcane_power Fluffy_Pillow 47006.5/67366: 70% mana arcane_charge(4), deathborne, crimson_chorus(2)
4:20.802 shared_cds { use_items Fluffy_Pillow 47006.5/67366: 70% mana arcane_charge(4), arcane_power, rune_of_power, deathborne, crimson_chorus(2)
4:20.802 shared_cds ~ berserking Fluffy_Pillow 47006.5/67366: 70% mana arcane_charge(4), arcane_power, rune_of_power, deathborne, crimson_chorus(2), gladiators_badge
4:20.802 aoe o arcane_blast Fluffy_Pillow 47006.5/67366: 70% mana berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne, crimson_chorus(2), gladiators_badge
4:22.007 aoe o arcane_blast Fluffy_Pillow 45192.6/67366: 67% mana berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne, crimson_chorus(2), gladiators_badge
4:23.214 aoe o arcane_blast Fluffy_Pillow 43381.3/67366: 64% mana berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne, crimson_chorus(2), gladiators_badge
4:24.419 aoe o arcane_blast Fluffy_Pillow 41567.3/67366: 62% mana berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne, crimson_chorus(3), gladiators_badge
4:25.624 aoe n presence_of_mind Fluffy_Pillow 39753.3/67366: 59% mana berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne, crimson_chorus(3), gladiators_badge
4:25.624 aoe o arcane_blast Fluffy_Pillow 39753.3/67366: 59% mana berserking, arcane_charge(4), arcane_power, presence_of_mind(3), rune_of_power, deathborne, crimson_chorus(3), gladiators_badge
4:26.808 aoe o arcane_blast Fluffy_Pillow 37911.0/67366: 56% mana berserking, arcane_charge(4), arcane_power, presence_of_mind(2), rune_of_power, deathborne, crimson_chorus(3), gladiators_badge
4:27.991 aoe o arcane_blast Fluffy_Pillow 36067.4/67366: 54% mana berserking, arcane_charge(4), arcane_power, presence_of_mind, rune_of_power, deathborne, crimson_chorus(3), gladiators_badge
4:29.173 aoe o arcane_blast Fluffy_Pillow 34222.4/67366: 51% mana berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne, crimson_chorus(3), gladiators_badge
4:30.378 aoe o arcane_blast Fluffy_Pillow 32408.4/67366: 48% mana berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne, crimson_chorus(3), gladiators_badge
4:31.584 aoe o arcane_blast Fluffy_Pillow 30595.8/67366: 45% mana berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, deathborne, crimson_chorus(3), gladiators_badge
4:32.791 aoe o arcane_blast Fluffy_Pillow 28784.5/67366: 43% mana berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, deathborne, crimson_chorus(3), gladiators_badge
4:33.994 aoe m rune_of_power Fluffy_Pillow 26967.8/67366: 40% mana arcane_charge(4), arcane_power, clearcasting, deathborne, crimson_chorus(3), gladiators_badge
4:35.294 aoe o arcane_blast Fluffy_Pillow 28719.3/67366: 43% mana arcane_charge(4), arcane_power, clearcasting, rune_of_power, deathborne, gladiators_badge
4:36.619 aoe o arcane_blast Fluffy_Pillow 23629.5/67366: 35% mana arcane_charge(4), clearcasting, rune_of_power, deathborne
4:37.946 aoe o arcane_blast Fluffy_Pillow 18542.4/67366: 28% mana arcane_charge(4), clearcasting, rune_of_power, deathborne
4:39.274 aoe o arcane_blast Fluffy_Pillow 13456.6/67366: 20% mana arcane_charge(4), clearcasting, rune_of_power, deathborne
4:40.599 aoe r arcane_barrage Fluffy_Pillow 8366.8/67366: 12% mana arcane_charge(4), clearcasting, rune_of_power
4:41.899 aoe p arcane_orb Fluffy_Pillow 12813.0/67366: 19% mana clearcasting(2), rune_of_power
4:43.200 aoe r arcane_barrage Fluffy_Pillow 14065.8/67366: 21% mana arcane_charge(4), clearcasting(2), rune_of_power
4:44.500 aoe q arcane_explosion Fluffy_Pillow 18512.0/67366: 27% mana clearcasting(2), rune_of_power
4:45.799 aoe q arcane_explosion Fluffy_Pillow 20262.1/67366: 30% mana arcane_charge, clearcasting, rune_of_power
4:47.099 aoe q arcane_explosion Fluffy_Pillow 22013.6/67366: 33% mana arcane_charge(2), rune_of_power
4:48.399 aoe q arcane_explosion Fluffy_Pillow 18765.1/67366: 28% mana arcane_charge(3), clearcasting
4:49.700 aoe r arcane_barrage Fluffy_Pillow 20518.0/67366: 30% mana arcane_charge(4)
4:50.999 aoe q arcane_explosion Fluffy_Pillow 24962.8/67366: 37% mana
4:52.300 aoe q arcane_explosion Fluffy_Pillow 21715.6/67366: 32% mana arcane_charge
4:53.600 aoe q arcane_explosion Fluffy_Pillow 18467.1/67366: 27% mana arcane_charge(2)
4:54.900 aoe q arcane_explosion Fluffy_Pillow 15218.7/67366: 23% mana arcane_charge(3)
4:56.199 aoe r arcane_barrage Fluffy_Pillow 11968.8/67366: 18% mana arcane_charge(4)
4:57.497 aoe q arcane_explosion Fluffy_Pillow 16412.3/67366: 24% mana
4:58.796 aoe q arcane_explosion Fluffy_Pillow 13162.4/67366: 20% mana arcane_charge
5:00.095 aoe q arcane_explosion Fluffy_Pillow 9912.6/67366: 15% mana arcane_charge(2)
5:01.394 shared_cds } time_warp Fluffy_Pillow 6662.7/67366: 10% mana arcane_charge(3)
5:01.394 aoe s evocation Fluffy_Pillow 4662.7/67366: 7% mana arcane_charge(3), temporal_warp
5:04.719 aoe q arcane_explosion Fluffy_Pillow 61885.6/67366: 92% mana arcane_charge(3), temporal_warp
5:05.718 aoe r arcane_barrage Fluffy_Pillow 58231.6/67366: 86% mana arcane_charge(4), temporal_warp, crimson_chorus
5:06.721 aoe p arcane_orb Fluffy_Pillow 62277.6/67366: 92% mana temporal_warp, crimson_chorus
5:07.722 aoe r arcane_barrage Fluffy_Pillow 63126.3/67366: 94% mana arcane_charge(4), temporal_warp, crimson_chorus
5:08.722 aoe q arcane_explosion Fluffy_Pillow 67168.2/67366: 100% mana temporal_warp, crimson_chorus
5:09.723 aoe q arcane_explosion Fluffy_Pillow 63516.9/67366: 94% mana arcane_charge, temporal_warp, crimson_chorus
5:10.723 aoe q arcane_explosion Fluffy_Pillow 59864.2/67366: 89% mana arcane_charge(2), clearcasting, temporal_warp, crimson_chorus
5:11.723 aoe q arcane_explosion Fluffy_Pillow 61211.5/67366: 91% mana arcane_charge(3), temporal_warp, crimson_chorus
5:12.724 aoe r arcane_barrage Fluffy_Pillow 57560.1/67366: 85% mana arcane_charge(4), temporal_warp, crimson_chorus
5:13.725 aoe q arcane_explosion Fluffy_Pillow 61603.4/67366: 91% mana temporal_warp, crimson_chorus
5:14.725 aoe q arcane_explosion Fluffy_Pillow 57950.7/67366: 86% mana arcane_charge, clearcasting, temporal_warp, crimson_chorus(2)
5:15.724 aoe q arcane_explosion Fluffy_Pillow 59296.7/67366: 88% mana arcane_charge(2), temporal_warp, crimson_chorus(2)
5:16.726 aoe q arcane_explosion Fluffy_Pillow 55646.7/67366: 83% mana arcane_charge(3), temporal_warp, crimson_chorus(2)
5:17.726 aoe r arcane_barrage Fluffy_Pillow 51994.0/67366: 77% mana arcane_charge(4), clearcasting, temporal_warp, crimson_chorus(2)
5:18.728 aoe q arcane_explosion Fluffy_Pillow 56038.7/67366: 83% mana clearcasting, temporal_warp, crimson_chorus(2)
5:19.730 aoe k touch_of_the_magi Fluffy_Pillow 57388.7/67366: 85% mana arcane_charge, temporal_warp, crimson_chorus(2)
5:20.731 aoe m rune_of_power Fluffy_Pillow 56237.3/67366: 83% mana arcane_charge(4), temporal_warp, crimson_chorus(2)
5:21.730 aoe r arcane_barrage Fluffy_Pillow 57583.3/67366: 85% mana arcane_charge(4), rune_of_power, temporal_warp, crimson_chorus(2)
5:22.729 aoe q arcane_explosion Fluffy_Pillow 61623.9/67366: 91% mana rune_of_power, temporal_warp, crimson_chorus(2)
5:23.730 aoe q arcane_explosion Fluffy_Pillow 57972.6/67366: 86% mana arcane_charge, clearcasting, rune_of_power, temporal_warp, crimson_chorus(2)
5:24.732 aoe q arcane_explosion Fluffy_Pillow 59322.6/67366: 88% mana arcane_charge(2), rune_of_power, temporal_warp, crimson_chorus(3)
5:25.732 aoe q arcane_explosion Fluffy_Pillow 55669.9/67366: 83% mana arcane_charge(3), rune_of_power, temporal_warp, crimson_chorus(3)
5:26.732 aoe r arcane_barrage Fluffy_Pillow 52017.2/67366: 77% mana arcane_charge(4), rune_of_power, temporal_warp, crimson_chorus(3)
5:27.735 aoe p arcane_orb Fluffy_Pillow 56063.2/67366: 83% mana rune_of_power, temporal_warp, crimson_chorus(3)
5:28.736 aoe r arcane_barrage Fluffy_Pillow 56911.9/67366: 84% mana arcane_charge(4), rune_of_power, temporal_warp, crimson_chorus(3)
5:29.736 aoe q arcane_explosion Fluffy_Pillow 60953.8/67366: 90% mana rune_of_power, temporal_warp, crimson_chorus(3)
5:30.736 aoe q arcane_explosion Fluffy_Pillow 57301.1/67366: 85% mana arcane_charge, rune_of_power, temporal_warp, crimson_chorus(3)
5:31.736 aoe q arcane_explosion Fluffy_Pillow 53648.4/67366: 80% mana arcane_charge(2), rune_of_power, temporal_warp, crimson_chorus(3)
5:32.736 aoe q arcane_explosion Fluffy_Pillow 49995.7/67366: 74% mana arcane_charge(3), rune_of_power, temporal_warp, crimson_chorus(3)
5:33.737 aoe r arcane_barrage Fluffy_Pillow 46344.4/67366: 69% mana arcane_charge(4), temporal_warp, crimson_chorus(3)
5:34.737 aoe q arcane_explosion Fluffy_Pillow 50386.3/67366: 75% mana temporal_warp
5:35.738 aoe q arcane_explosion Fluffy_Pillow 46735.0/67366: 69% mana arcane_charge, temporal_warp
5:36.738 aoe q arcane_explosion Fluffy_Pillow 43082.3/67366: 64% mana arcane_charge(2), temporal_warp
5:37.738 aoe q arcane_explosion Fluffy_Pillow 39429.6/67366: 59% mana arcane_charge(3), temporal_warp
5:38.739 aoe r arcane_barrage Fluffy_Pillow 35778.3/67366: 53% mana arcane_charge(4), temporal_warp
5:39.739 aoe q arcane_explosion Fluffy_Pillow 39820.2/67366: 59% mana temporal_warp
5:40.740 aoe q arcane_explosion Fluffy_Pillow 36168.9/67366: 54% mana arcane_charge, temporal_warp
5:41.741 aoe q arcane_explosion Fluffy_Pillow 32517.6/67366: 48% mana arcane_charge(2)
5:43.041 aoe q arcane_explosion Fluffy_Pillow 29269.1/67366: 43% mana arcane_charge(3)
5:44.340 aoe r arcane_barrage Fluffy_Pillow 26019.2/67366: 39% mana arcane_charge(4)
5:45.639 aoe q arcane_explosion Fluffy_Pillow 30464.0/67366: 45% mana
5:46.938 aoe q arcane_explosion Fluffy_Pillow 27214.2/67366: 40% mana arcane_charge
5:48.238 aoe q arcane_explosion Fluffy_Pillow 23965.7/67366: 36% mana arcane_charge(2)
5:49.538 aoe q arcane_explosion Fluffy_Pillow 20717.2/67366: 31% mana arcane_charge(3)

Stats

Level Bonus (60) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 198 1 199 199 0
Agility 306 2 308 308 0
Stamina 414 0 2013 1918 1504
Intellect 450 -3 1767 1588 1066 (46)
Spirit 0 0 0 0 0
Health 40260 38360 0
Mana 67366 67366 0
Spell Power 1767 1588 0
Crit 15.74% 15.74% 376
Haste 15.76% 15.76% 520
Versatility 7.97% 7.97% 319
Mana Regen 1347 1347 0
Mastery 34.73% 34.73% 733
Armor 369 369 369
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 227.00
Local Head Confidant's Favored Cap
ilevel: 226, stats: { 44 Armor, +82 Int, +149 Sta, +44 Haste, +98 Mastery }
Local Neck Noble's Birthstone Pendant
ilevel: 226, stats: { +84 Sta, +52 Crit, +162 Mastery }
Local Shoulders Shawl of the Penitent
ilevel: 233, stats: { 42 Armor, +65 Int, +122 Sta, +33 Crit, +76 Haste }
Local Chest Robes of the Cursed Commando
ilevel: 233, stats: { 61 Armor, +87 Int, +162 Sta, +47 Crit, +100 Haste }, enchant: { +20 Int }
Local Waist Cinch of Infinite Tightness
ilevel: 226, stats: { 33 Armor, +61 Int, +112 Sta, +69 Crit, +36 Vers }
Local Legs Courtier's Costume Trousers
ilevel: 226, stats: { 51 Armor, +82 Int, +149 Sta, +49 Vers, +93 Mastery }
Local Feet Slippers of the Forgotten Heretic
ilevel: 226, stats: { 36 Armor, +61 Int, +112 Sta, +73 Crit, +32 Mastery }
Local Wrists Acolyte's Velvet Bindings
ilevel: 226, stats: { 29 Armor, +46 Int, +84 Sta, +26 Vers, +53 Mastery }, enchant: { +15 Int }
Local Hands Impossibly Oversized Mitts
ilevel: 226, stats: { 33 Armor, +61 Int, +112 Sta, +31 Haste, +74 Mastery }
Local Finger1 Most Regal Signet of Sire Denathrius
ilevel: 233, stats: { +91 Sta, +178 Haste, +48 Mastery }, enchant: { +16 Mastery }
item effects: { equip: Denathrius' Privilege }
Local Finger2 Shadowghast Ring
ilevel: 235, stats: { +94 Sta, +115 Mastery, +115 Vers }, enchant: { +16 Mastery }
item effects: { equip: Temporal Warp }
Local Trinket1 Cabalist's Hymnal
ilevel: 226, stats: { +77 Int }
item effects: { equip: Crimson Chorus }
Local Trinket2 Sinful Aspirant's Badge of Ferocity
ilevel: 207, stats: { +91 Haste }
item effects: { use: Gladiator's Badge }
Local Back Mantle of Manifest Sins
ilevel: 226, stats: { 40 Armor, +84 Sta, +53 Crit, +26 Mastery, +46 StrAgiInt }
Local Main Hand Staff of the Penitent
ilevel: 226, weapon: { 93 - 128, 3.6 }, stats: { +82 Int, +281 Int, +149 Sta, +49 Crit, +93 Vers }, enchant: sinful_revelation

Profile

mage="Necrolord_Marileth"
source=default
spec=arcane
level=60
race=troll
role=spell
position=back
talents=1031021
talent_override=resonance,if=3>2
covenant=necrolord
soulbind=arcane_prodigy:6//51:6

# Default consumables
potion=deathly_fixation
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=variable,name=prepull_evo,op=reset,default=0
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
actions.precombat+=/variable,name=have_opened,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
actions.precombat+=/variable,name=final_burn,op=set,value=0
actions.precombat+=/variable,name=rs_max_delay,op=reset,default=5
actions.precombat+=/variable,name=ap_max_delay,op=reset,default=10
actions.precombat+=/variable,name=rop_max_delay,op=reset,default=20
actions.precombat+=/variable,name=totm_max_delay,op=reset,default=5
actions.precombat+=/variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
actions.precombat+=/variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
actions.precombat+=/variable,name=barrage_mana_pct,op=reset,default=70
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=reset,default=30
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
actions.precombat+=/variable,name=totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=aoe_totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=am_spam,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
actions.precombat+=/variable,name=am_spam_evo_pct,op=reset,default=15
actions.precombat+=/flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_familiar
actions.precombat+=/arcane_intellect
actions.precombat+=/conjure_mana_gem
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/frostbolt,if=variable.prepull_evo<=0
actions.precombat+=/evocation,if=variable.prepull_evo>0

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/call_action_list,name=shared_cds
actions+=/call_action_list,name=essences
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/call_action_list,name=opener,if=variable.have_opened<=0
actions+=/call_action_list,name=am_spam,if=variable.am_spam=1
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=rotation,if=variable.final_burn=0
actions+=/call_action_list,name=final_burn,if=variable.final_burn=1
actions+=/call_action_list,name=movement

actions.am_spam=cancel_action,if=action.evocation.channeling&mana.pct>=95
actions.am_spam+=/evocation,if=mana.pct<=variable.am_spam_evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/rune_of_power,if=buff.rune_of_power.down&cooldown.arcane_power.remains>0
actions.am_spam+=/touch_of_the_magi,if=(cooldown.arcane_power.remains=0&buff.rune_of_power.down)|prev_gcd.1.rune_of_power
actions.am_spam+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&buff.rune_of_power.down&essence.vision_of_perfection.enabled
actions.am_spam+=/arcane_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.ap_max_delay
actions.am_spam+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=action.arcane_missiles.execute_time&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_barrage,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_missiles,if=buff.clearcasting.react,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/arcane_missiles,if=!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.am_spam+=/arcane_barrage
actions.am_spam+=/arcane_blast

actions.aoe=frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
actions.aoe+=/arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
actions.aoe+=/mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
actions.aoe+=/arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
actions.aoe+=/rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
actions.aoe+=/presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
actions.aoe+=/arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
actions.aoe+=/supernova
actions.aoe+=/arcane_orb,if=buff.arcane_charge.stack=0
actions.aoe+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
actions.aoe+=/arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1

# Prioritize using grisly icicle with ap. Use it with totm otherwise.
actions.cooldowns=frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.cooldowns+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
# Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
# Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
actions.cooldowns+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
# Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
# Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
# Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
actions.cooldowns+=/arcane_power,if=(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
actions.cooldowns+=/rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
# Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
actions.cooldowns+=/presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
# Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.cooldowns+=/presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled

actions.essences=blood_of_the_enemy,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/blood_of_the_enemy,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains>=50&cooldown.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay
actions.essences+=/worldvein_resonance,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/guardian_of_azeroth,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/guardian_of_azeroth,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/concentrated_flame,line_cd=6,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/reaping_flames,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/focused_azerite_beam,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/purifying_blast,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/ripple_in_space,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/the_unbound_force,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/memory_of_lucid_dreams,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down

actions.final_burn=arcane_missiles,if=buff.clearcasting.react,chain=1
actions.final_burn+=/arcane_blast
actions.final_burn+=/arcane_barrage

actions.movement=blink_any,if=movement.distance>=10
actions.movement+=/presence_of_mind
actions.movement+=/arcane_missiles,if=movement.distance<10
actions.movement+=/arcane_orb
actions.movement+=/fire_blast

actions.opener=variable,name=have_opened,op=set,value=1,if=prev_gcd.1.evocation
actions.opener+=/fire_blast,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command_frost.up
actions.opener+=/frost_nova,if=runeforge.grisly_icicle.equipped&mana.pct>95
actions.opener+=/mirrors_of_torment
actions.opener+=/deathborne
actions.opener+=/radiant_spark,if=mana.pct>40
actions.opener+=/cancel_action,if=action.shifting_power.channeling&gcd.remains=0
actions.opener+=/shifting_power,if=soulbind.field_of_blossoms.enabled
actions.opener+=/touch_of_the_magi
actions.opener+=/arcane_power
actions.opener+=/rune_of_power,if=buff.rune_of_power.down
actions.opener+=/presence_of_mind
actions.opener+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.opener+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.opener+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.opener+=/arcane_missiles,if=buff.clearcasting.react,chain=1
actions.opener+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges&(cooldown.arcane_power.remains>10|active_enemies<=2)
actions.opener+=/arcane_blast,if=buff.rune_of_power.up|mana.pct>15
actions.opener+=/evocation,if=buff.rune_of_power.down,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.opener+=/arcane_barrage

actions.rotation=variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
actions.rotation+=/strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
actions.rotation+=/arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
actions.rotation+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.rotation+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.rotation+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
actions.rotation+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
actions.rotation+=/supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.rotation+=/arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
actions.rotation+=/arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_blast
actions.rotation+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.rotation+=/arcane_barrage

actions.shared_cds=use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
actions.shared_cds+=/use_items,if=buff.arcane_power.up
actions.shared_cds+=/potion,if=buff.arcane_power.up
actions.shared_cds+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
actions.shared_cds+=/lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/berserking,if=buff.arcane_power.up
actions.shared_cds+=/blood_fury,if=buff.arcane_power.up
actions.shared_cds+=/fireblood,if=buff.arcane_power.up
actions.shared_cds+=/ancestral_call,if=buff.arcane_power.up

head=confidants_favored_cap,id=183021,bonus_id=1498,ilevel=226
neck=nobles_birthstone_pendant,id=183039,bonus_id=1498,ilevel=226
shoulders=shawl_of_the_penitent,id=183020,bonus_id=1498,ilevel=233
back=mantle_of_manifest_sins,id=183033,bonus_id=1498,ilevel=226
chest=robes_of_the_cursed_commando,id=182998,bonus_id=1498,ilevel=233,enchant=eternal_insight
wrists=acolytes_velvet_bindings,id=183017,bonus_id=1498,ilevel=226,enchant=eternal_intellect
hands=impossibly_oversized_mitts,id=183022,bonus_id=1498,ilevel=226
waist=cinch_of_infinite_tightness,id=183028,bonus_id=1498,ilevel=226
legs=courtiers_costume_trousers,id=183011,bonus_id=1498,ilevel=226
feet=slippers_of_the_forgotten_heretic,id=182979,bonus_id=1498,ilevel=226
finger1=most_regal_signet_of_sire_denathrius,id=183036,bonus_id=1498,ilevel=233,enchant=16mastery
finger2=shadowghast_ring,id=178926,bonus_id=6648/6650/6758/6834/1532,ilevel=235,enchant=16mastery
trinket1=cabalists_hymnal,id=184028,bonus_id=1498,ilevel=226
trinket2=sinful_aspirants_badge_of_ferocity,id=175884,bonus_id=1521,ilevel=207
main_hand=staff_of_the_penitent,id=180000,bonus_id=7187/6652/1524,ilevel=226,enchant=sinful_revelation

# Gear Summary
# gear_ilvl=226.73
# gear_stamina=1504
# gear_intellect=1066
# gear_crit_rating=376
# gear_haste_rating=520
# gear_mastery_rating=733
# gear_versatility_rating=319
# gear_armor=369

NightFae_Dream : 8974 dps, 3782 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
8973.9 8973.9 10.3 / 0.114% 747.1 / 8.3% 4.3
RPS Out RPS In Primary Resource Waiting APM Active Skill
2085.2 1978.7 Mana 0.00% 52.9 100.0% 100%
Talents
Night Fae
Runeforge

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
NightFae_Dream 8974
Arcane Barrage 3325 37.0% 58.7 5.12sec 16976 14795 Direct 175.8 4763 9617 5666 18.6%

Stats Details: Arcane Barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 58.69 175.81 0.00 0.00 1.1474 0.0000 996283.36 996283.36 0.00% 14794.82 14794.82
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.39% 143.09 104 183 4763.08 2155 14549 4765.20 4345 5160 681577 681577 0.00%
crit 18.61% 32.72 15 52 9616.61 4309 29099 9629.69 6370 13307 314706 314706 0.00%

Action Details: Arcane Barrage

  • id:44425
  • school:arcane
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.728000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=0 + 72.8%} Arcane damage. For each Arcane Charge, deals {$36032s2=30}% additional damage$?a321526[, grants you {$321526s1=2}% of your maximum mana,][]$?a231564[ and hits {$36032s3=0} additional nearby $Ltarget:targets; for {$s2=40}% of its damage][]. |cFFFFFFFFConsumes all Arcane Charges.|r

Action Priority List

    aoe
    [p]:58.69
  • if_expr:buff.arcane_charge.stack=buff.arcane_charge.max_stack
Arcane Explosion 3805 42.4% 155.5 1.91sec 7334 6433 Direct 466.6 2058 4142 2445 18.5%

Stats Details: Arcane Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 155.52 466.57 0.00 0.00 1.1400 0.0000 1140569.73 1140569.73 0.00% 6433.03 6433.03
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.45% 380.05 288 466 2057.99 1427 3855 2058.55 1955 2164 782204 782204 0.00%
crit 18.55% 86.53 48 128 4141.96 2855 7710 4144.04 3650 4750 358366 358366 0.00%

Action Details: Arcane Explosion

  • id:1449
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.502320
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s2=0 + 50.2%} Arcane damage to all enemies within $A2 yards.$?a137021[ |cFFFFFFFFGenerates {$s1=1} Arcane Charge if any targets are hit.|r][]

Action Priority List

    aoe
    [o]:155.55
  • if_expr:buff.arcane_charge.stack<buff.arcane_charge.max_stack
Arcane Orb 0 (725) 0.0% (8.1%) 14.2 21.66sec 15248 13204

Stats Details: Arcane Orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.22 0.00 0.00 0.00 1.1548 0.0000 0.00 0.00 0.00% 13204.09 13204.09

Action Details: Arcane Orb

  • id:153626
  • school:arcane
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:153626
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r

Action Priority List

    aoe
    [m]:14.22
  • if_expr:buff.arcane_charge.stack=0
    Arcane Orb (_bolt) 725 8.1% 42.6 21.66sec 5091 0 Direct 42.6 4291 8592 5090 18.6%

Stats Details: Arcane Orb Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 42.59 42.59 0.00 0.00 0.0000 0.0000 216850.77 216850.77 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.41% 34.67 24 47 4291.26 2821 7619 4296.18 3521 4789 148785 148785 0.00%
crit 18.59% 7.92 1 17 8591.92 5642 15237 8613.08 5642 14806 68066 68066 0.00%

Action Details: Arcane Orb Bolt

  • id:153640
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.092000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:153640
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:{$@spelldesc153626=Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r}
Deathly Fixation 0 (103) 0.0% (1.2%) 22.8 7.44sec 1371 0

Stats Details: Deathly Fixation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 22.78 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Deathly Fixation

  • id:322253
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:42.90
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322253
  • name:Deathly Fixation
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1.
  • description:Deal {$s1=43} Shadow damage every $t1. Stacks up to 5 times.
    Deathly Eruption 103 1.2% 22.8 7.44sec 1371 0 Direct 22.8 1138 2279 1371 20.4%

Stats Details: Deathly Eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 22.78 22.78 0.00 0.00 0.0000 0.0000 31219.00 31219.00 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.62% 18.13 8 33 1138.13 1117 1184 1137.98 1117 1179 20640 20640 0.00%
crit 20.38% 4.64 0 13 2279.37 2233 2367 2245.89 0 2367 10579 10579 0.00%

Action Details: Deathly Eruption

  • id:322256
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:984.99
  • base_dd_max:984.99
  • base_dd_mult:1.00

Spelldata

  • id:322256
  • name:Deathly Eruption
  • school:shadow
  • tooltip:
  • description:Deal {$s1=985} Shadow damage.
Eternal Insight 40 0.4% 21.8 13.22sec 552 0 Direct 21.8 464 928 551 18.8%

Stats Details: Eternal Insight

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 21.82 21.82 0.00 0.00 0.0000 0.0000 12034.82 12034.82 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.16% 17.71 6 35 464.14 453 481 464.20 455 477 8219 8219 0.00%
crit 18.84% 4.11 0 12 928.15 907 961 916.15 0 961 3816 3816 0.00%

Action Details: Eternal Insight

  • id:342314
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:400.00
  • base_dd_max:400.00
  • base_dd_mult:1.00

Spelldata

  • id:342314
  • name:Eternal Insight
  • school:shadow
  • tooltip:
  • description:Deals {$s1=400} Shadow damage.
Frostbolt 4 0.0% 0.0 0.00sec 0 0 Direct 1.0 1024 2047 1179 15.1%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 1.00 0.00 0.00 0.0000 0.0000 1178.14 1178.14 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.91% 0.85 0 1 1023.69 1024 1024 869.25 0 1024 869 869 0.00%
crit 15.09% 0.15 0 1 2047.39 2047 2047 308.89 0 2047 309 309 0.00%

Action Details: Frostbolt

  • id:116
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.511000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116
  • name:Frostbolt
  • school:frost
  • tooltip:
  • description:Launches a bolt of frost at the enemy, causing {$228597s1=0} Frost damage and slowing movement speed by {$205708s1=50}% for {$205708d=8 seconds}.
Mirror Image 0 (19) 0.0% (0.2%) 1.0 0.00sec 5699 0

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.
    Frostbolt (mirror_image) 142  / 19 0.2% 117.0 0.99sec 49 48 Direct 117.0 41 82 49 19.9%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 117.00 117.00 0.00 0.00 1.0091 0.0000 5699.05 5699.05 0.00% 48.27 48.27
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.08% 93.69 79 105 40.54 30 51 40.54 39 42 3798 3798 0.00%
crit 19.92% 23.31 12 38 81.53 59 101 81.54 67 92 1901 1901 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:40.00
Shifting Power 278 3.1% 6.1 48.01sec 13661 4077 Periodic 72.8 958 1915 1144 19.5% 2.1%

Stats Details: Shifting Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.10 0.00 24.27 72.82 3.3507 0.7788 83330.27 83330.27 0.00% 4077.02 4077.02
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.50% 58.62 39 79 957.70 949 1006 957.67 949 975 56140 56140 0.00%
crit 19.50% 14.20 4 26 1915.04 1898 2011 1914.97 1898 1973 27190 27190 0.00%

Action Details: Shifting Power

  • id:314791
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:4.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:314791
  • name:Shifting Power
  • school:nature
  • tooltip:Every $t1 sec, deal {$325130s1=0} Nature damage to enemies within $325130A1 yds and reduce the remaining cooldown of your abilities by ${-{$s2=3000}/1000} sec.
  • description:Draw power from the ground beneath, dealing ${{$325130s1=0}*{$d=4 seconds}/$t} Nature damage over {$d=4 seconds} to enemies within $325130A1 yds. While channeling, your Mage ability cooldowns are reduced by ${-{$s2=3000}/1000*{$d=4 seconds}/$t} sec over {$d=4 seconds}.

Action Details: Shifting Power Pulse

  • id:325130
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:18.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.473600
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:325130
  • name:Shifting Power
  • school:nature
  • tooltip:
  • description:{$@spelldesc314791=Draw power from the ground beneath, dealing ${{$325130s1=0}*{$d=4 seconds}/$t} Nature damage over {$d=4 seconds} to enemies within $325130A1 yds. While channeling, your Mage ability cooldowns are reduced by ${-{$s2=3000}/1000*{$d=4 seconds}/$t} sec over {$d=4 seconds}.}

Action Priority List

    aoe
    [n]:6.10
  • if_expr:buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
Touch of the Magi 0 (674) 0.0% (7.5%) 7.0 45.77sec 28737 22770

Stats Details: Touch Of The Magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 7.03 0.00 0.00 0.00 1.2622 0.0000 0.00 0.00 0.00% 22769.52 22769.52

Action Details: Touch Of The Magi

  • id:321507
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:4.0

Spelldata

  • id:321507
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]

Action Priority List

    aoe
    [j]:7.06
  • if_expr:buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
    Touch of the Magi (_explosion) 674 7.5% 7.0 45.64sec 28737 0 Direct 21.0 9627 0 9627 0.0%

Stats Details: Touch Of The Magi Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 7.03 20.98 0.00 0.00 0.0000 0.0000 201920.08 201920.08 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 20.98 15 27 9626.50 1480 44046 9723.37 6963 14266 201920 201920 0.00%

Action Details: Touch Of The Magi Explosion

  • id:210833
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:15516.23
  • base_dd_max:15516.23
  • base_dd_mult:1.00

Spelldata

  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc321507=Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]}
Simple Action Stats Execute Interval
NightFae_Dream
Arcane Power 3.6 97.60sec

Stats Details: Arcane Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.55 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Power

  • id:12042
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].

Action Priority List

    aoe
    [k]:3.56
  • if_expr:((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
Berserking 2.0 194.93sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    shared_cds
    [v]:2.00
  • if_expr:buff.arcane_power.up
Conjure Mana Gem 1.0 0.00sec

Stats Details: Conjure Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Conjure Mana Gem

  • id:759
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:9000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:759
  • name:Conjure Mana Gem
  • school:arcane
  • tooltip:
  • description:Conjures a Mana Gem that can be used to instantly restore {$5405s1=10}% mana, and holds up to {$s2=3} charges. $@spellname118812 {$@spelldesc118812=Conjured items disappear if logged out for more than 15 minutes.}
Evocation 0.4 186.14sec

Stats Details: Evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.45 0.00 2.64 0.00 3.7470 0.6349 0.00 0.00 0.00% 0.00 0.00

Action Details: Evocation

  • id:12051
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Dream
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.

Action Priority List

    aoe
    [q]:0.45
  • interrupt_if_expr:mana.pct>=85
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Dream
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Dream
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Deathly Fixation (potion) 1.5 300.59sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.49 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307497
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    shared_cds
    [t]:1.49
  • if_expr:buff.arcane_power.up
Rune of Power 6.9 43.91sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.93 0.00 0.00 0.00 1.1857 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    aoe
    [l]:6.95
  • if_expr:buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Time Warp 2.0 240.36sec

Stats Details: Time Warp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.99 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Time Warp

  • id:80353
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:2000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:80353
  • name:Time Warp
  • school:arcane
  • tooltip:Haste increased by $w1%. $?$W4>0[Time rate increased by $w4%.][]$?$W3=1[ When the effect ends, you die.][]
  • description:Warp the flow of time, increasing haste by {$s1=30}% $?a320919[and time rate by {$s4=0}% ][]for all party and raid members for {$d=40 seconds}. Allies will be unable to benefit from Bloodlust, Heroism, or Time Warp again for {$57724d=600 seconds}.$?a320920[ When the effect ends, you die.][]

Action Priority List

    shared_cds
    [u]:1.99
  • if_expr:runeforge.temporal_warp.equipped&buff.exhaustion.up
Replenish Mana (use_mana_gem) 2.8 121.37sec

Stats Details: Use Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.84 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Use Mana Gem

  • id:5405
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Dream
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5405
  • name:Replenish Mana
  • school:physical
  • tooltip:Restoring $w2 mana every $t1 sec.
  • description:Restores {$s1=10}% mana.

Action Priority List

    shared_cds
    [r]:2.84
  • if_expr:(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Arcane Charge 59.4 159.9 5.1sec 1.4sec 3.7sec 73.77% 0.00% 2.6 (3.8) 0.0

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.8s / 15.8s
  • trigger_min/max:0.0s / 9.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 13.4s

Stack Uptimes

  • arcane_charge_1:18.81%
  • arcane_charge_2:16.25%
  • arcane_charge_3:17.22%
  • arcane_charge_4:21.49%

Spelldata

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 3.6 0.0 97.6sec 97.6sec 14.7sec 17.41% 0.00% 0.0 (0.0) 3.4

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:96.0s / 113.1s
  • trigger_min/max:96.0s / 113.1s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 15.0s

Stack Uptimes

  • arcane_power_1:17.41%

Spelldata

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Berserking 2.0 0.0 195.0sec 195.0sec 12.0sec 8.11% 6.51% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:192.6s / 201.3s
  • trigger_min/max:192.6s / 201.3s
  • trigger_pct:100.00%
  • duration_min/max:12.0s / 12.0s

Stack Uptimes

  • berserking_1:8.11%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.51% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.51%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Clearcasting 24.4 0.2 12.0sec 11.8sec 2.0sec 16.58% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_clearcasting
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • clearcasting_1:16.30%
  • clearcasting_2:0.29%

Spelldata

  • id:263725
  • name:Clearcasting
  • tooltip:Your next Arcane Missiles or Arcane Explosion costs no mana{$?s321758=false}[ and Arcane Missiles fires an additional missile][].
  • description:{$@spelldesc79684=For each ${$c*100/{$s1=200}} mana you spend, you have a 1% chance to gain Clearcasting, making your next Arcane Missiles or Arcane Explosion free and channel {$277726s1=20}% faster.$?a321758[ Arcane Missiles fires {$321758s2=1} additional missile.][]}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Crimson Chorus 5.5 0.0 60.6sec 60.6sec 28.6sec 52.03% 0.00% 0.0 (0.0) 4.9

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_crimson_chorus
  • max_stacks:3
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:60.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:10.00
  • associated item:Cabalist's Hymnal

Stat Details

  • stat:crit_rating
  • amount:95.00

Trigger Details

  • interval_min/max:60.0s / 66.3s
  • trigger_min/max:60.0s / 66.3s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 30.0s

Stack Uptimes

  • crimson_chorus_1:17.94%
  • crimson_chorus_2:17.34%
  • crimson_chorus_3:16.75%

Spelldata

  • id:344803
  • name:Crimson Chorus
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc344806=Join the Crimson Chorus. Every minute, your Critical Strike swells by ${{$s1=44}*3} over ${{$344803d=10 seconds}*3} sec. before returning to normal. This effect is increased by {$s2=5}% for each member of the Crimson Chorus in your party.}
  • max_stacks:3
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Evocation 0.4 0.0 178.9sec 178.9sec 3.8sec 0.54% 0.00% 1.8 (1.8) 0.0

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_evocation
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:7.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:1.00

Trigger Details

  • interval_min/max:94.4s / 198.7s
  • trigger_min/max:94.4s / 198.7s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 4.3s

Stack Uptimes

  • evocation_1:0.55%

Spelldata

  • id:12051
  • name:Evocation
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Gladiator's Badge 3.6 0.0 97.6sec 97.6sec 14.7sec 17.41% 0.00% 0.0 (0.0) 3.4

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_gladiators_badge
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Sinful Aspirant's Badge of Ferocity

Stat Details

  • stat:intellect
  • amount:342.00

Trigger Details

  • interval_min/max:96.0s / 113.1s
  • trigger_min/max:96.0s / 113.1s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 15.0s

Stack Uptimes

  • gladiators_badge_1:17.41%

Spelldata

  • id:345228
  • name:Gladiator's Badge
  • tooltip:Primary stat increased by $w1.
  • description:Increases primary stat by {$s1=252} for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:0.00%
Potion of Deathly Fixation 1.5 0.0 300.5sec 300.5sec 23.1sec 11.26% 0.00% 0.0 (0.0) 1.3

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_potion_of_deathly_fixation
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:300.0s / 306.7s
  • trigger_min/max:300.0s / 306.7s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 25.0s

Stack Uptimes

  • potion_of_deathly_fixation_1:11.26%

Spelldata

  • id:307497
  • name:Potion of Deathly Fixation
  • tooltip:Chance to apply Deathly Fixation to your target.
  • description:Your damaging spells and abilities have a chance to apply Deathly Fixation to your target, dealing {$322253s1=43} Shadow damage over {$322253d=8 seconds} and stacking up to 5 times. Upon reaching 5 stacks, Deathly Fixation explodes, dealing {$322256s1=985} Shadow damage to the target. If you consume this potion while your weapon is augmented with Shadowcore Oil, the explosion damage is increased by {$s2=10}%. Lasts {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Rune of Power 10.5 0.0 29.6sec 29.6sec 11.8sec 41.12% 0.00% 0.0 (0.0) 10.1

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.0s / 55.1s
  • trigger_min/max:13.0s / 55.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • rune_of_power_1:41.12%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Temporal Warp 2.0 0.0 240.4sec 240.4sec 36.8sec 24.25% 0.00% 0.0 (0.0) 1.7

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_temporal_warp
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:240.0s / 241.3s
  • trigger_min/max:240.0s / 241.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 40.0s

Stack Uptimes

  • temporal_warp_1:24.25%

Spelldata

  • id:327355
  • name:Temporal Warp
  • tooltip:Haste increased by $w1%.
  • description:{$@spelldesc327351=While you have Temporal Displacement or other similar effects, you may use Time Warp to grant yourself {$327355s1=30}% Haste for {$327355d=40 seconds}.}
  • max_stacks:0
  • duration:40.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism)

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Benefit Avg % Min Max
Arcane Barrage Arcane Charge 4 100.00% 100.00% 100.00%
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 1.19% 0.35% 7.11% 0.8s 0.0s 4.7s
Conserve Phase 100.00% 100.00% 100.00% 299.9s 240.2s 360.0s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.0000.0000.000203.943144.203263.964
Evocation225.04725.426350.470277.840165.062359.884
Rune of Power8.3420.00337.73859.92021.812112.388
Touch of the Magi7.4220.00022.14653.57317.397107.553
Arcane Power1.5380.00017.1005.5132.29820.009
Arcane Barrage2.8310.00012.081167.351134.007202.445
Arcane Orb3.7310.00010.93453.55236.33374.277
Shifting Power6.9900.00037.10544.17129.93967.897
Time Warp0.8310.0001.3031.6531.2972.562

Burn Phases

Burn phase duration tracks the amount of time spent in each burn phase. This is defined as the time between a start_burn_phase and stop_burn_phase action being executed. Note that "execute" burn phases, i.e., the final burn of a fight, is also included.

Burn Phase Duration
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Mana at burn start is the mana level recorded (in percentage of total mana) when a start_burn_phase command is executed.

Mana at Burn Start
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
NightFae_Dream
mana_regen Mana 686.36 397912.42 67.03% 579.75 5671.03 1.41%
Evocation Mana 19.04 22993.96 3.87% 1207.73 0.00 0.00%
Mana Gem Mana 2.84 19150.03 3.23% 6736.57 0.00 0.00%
Arcane Barrage Mana 58.69 153616.28 25.88% 2617.42 4531.17 2.87%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 66365.7 1978.75 2085.20 10190.6 35435.0 352.2 67365.7
Usage Type Count Total Avg RPE APR
NightFae_Dream
arcane_explosion Mana 155.5 581488.8 3738.4 3738.9 2.0
arcane_orb Mana 14.2 6308.1 443.6 443.6 34.4
shifting_power Mana 6.1 15247.2 2500.0 2499.5 5.5
time_warp Mana 2.0 3976.0 2000.0 2000.1 0.0
touch_of_the_magi Mana 7.0 17549.6 2497.7 2497.6 11.5

Statistics & Data Analysis

Fight Length
NightFae_Dream Fight Length
Count 1319
Mean 299.94
Minimum 240.20
Maximum 359.96
Spread ( max - min ) 119.76
Range [ ( max - min ) / 2 * 100% ] 19.96%
DPS
NightFae_Dream Damage Per Second
Count 1319
Mean 8973.85
Minimum 8393.71
Maximum 9563.55
Spread ( max - min ) 1169.84
Range [ ( max - min ) / 2 * 100% ] 6.52%
Standard Deviation 190.0000
5th Percentile 8673.75
95th Percentile 9285.42
( 95th Percentile - 5th Percentile ) 611.67
Mean Distribution
Standard Deviation 5.2316
95.00% Confidence Interval ( 8963.60 - 8984.10 )
Normalized 95.00% Confidence Interval ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 18
0.1% Error 1723
0.1 Scale Factor Error with Delta=300 309
0.05 Scale Factor Error with Delta=300 1233
0.01 Scale Factor Error with Delta=300 30818
Priority Target DPS
NightFae_Dream Priority Target Damage Per Second
Count 1319
Mean 3781.99
Minimum 3446.04
Maximum 4283.55
Spread ( max - min ) 837.51
Range [ ( max - min ) / 2 * 100% ] 11.07%
Standard Deviation 121.5637
5th Percentile 3590.70
95th Percentile 3985.27
( 95th Percentile - 5th Percentile ) 394.57
Mean Distribution
Standard Deviation 3.3472
95.00% Confidence Interval ( 3775.43 - 3788.55 )
Normalized 95.00% Confidence Interval ( 99.83% - 100.17% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 40
0.1% Error 3969
0.1 Scale Factor Error with Delta=300 127
0.05 Scale Factor Error with Delta=300 505
0.01 Scale Factor Error with Delta=300 12616
DPS(e)
NightFae_Dream Damage Per Second (Effective)
Count 1319
Mean 8973.85
Minimum 8393.71
Maximum 9563.55
Spread ( max - min ) 1169.84
Range [ ( max - min ) / 2 * 100% ] 6.52%
Damage
NightFae_Dream Damage
Count 1319
Mean 2683386.18
Minimum 2138037.34
Maximum 3242559.81
Spread ( max - min ) 1104522.47
Range [ ( max - min ) / 2 * 100% ] 20.58%
DTPS
NightFae_Dream Damage Taken Per Second
Count 1319
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
NightFae_Dream Healing Per Second
Count 1319
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
NightFae_Dream Healing Per Second (Effective)
Count 1319
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
NightFae_Dream Heal
Count 1319
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
NightFae_Dream Healing Taken Per Second
Count 1319
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
NightFae_Dream Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
NightFae_DreamTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
NightFae_Dream Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 variable,name=prepull_evo,op=reset,default=0
1 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
2 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
3 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
4 0.00 variable,name=have_opened,op=reset,default=0
5 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
6 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
7 0.00 variable,name=final_burn,op=set,value=0
8 0.00 variable,name=rs_max_delay,op=reset,default=5
9 0.00 variable,name=ap_max_delay,op=reset,default=10
A 0.00 variable,name=rop_max_delay,op=reset,default=20
B 0.00 variable,name=totm_max_delay,op=reset,default=5
C 0.00 variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
D 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
E 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
F 0.00 variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
G 0.00 variable,name=barrage_mana_pct,op=reset,default=70
H 0.00 variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
I 0.00 variable,name=ap_minimum_mana_pct,op=reset,default=30
J 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
K 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
L 0.00 variable,name=totm_max_charges,op=reset,default=2
M 0.00 variable,name=aoe_totm_max_charges,op=reset,default=2
N 0.00 variable,name=am_spam,op=reset,default=0
O 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
P 0.00 variable,name=am_spam_evo_pct,op=reset,default=15
Q 0.00 flask
R 0.00 food
S 0.00 augmentation
T 0.00 arcane_familiar
U 0.00 arcane_intellect
V 0.00 conjure_mana_gem
W 0.00 snapshot_stats
X 0.00 mirror_image
Y 0.00 frostbolt,if=variable.prepull_evo<=0
Z 0.00 evocation,if=variable.prepull_evo>0
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
a 0.00 call_action_list,name=shared_cds
b 0.00 call_action_list,name=essences
c 0.00 call_action_list,name=aoe,if=active_enemies>2
d 0.00 call_action_list,name=opener,if=variable.have_opened<=0
e 0.00 call_action_list,name=am_spam,if=variable.am_spam=1
f 0.00 call_action_list,name=cooldowns
g 0.00 call_action_list,name=rotation,if=variable.final_burn=0
h 0.00 call_action_list,name=final_burn,if=variable.final_burn=1
i 0.00 call_action_list,name=movement
actions.aoe
# count action,conditions
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
0.00 arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
0.00 mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
j 7.06 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
k 3.56 arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
l 6.95 rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
0.00 presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
0.00 arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
0.00 supernova
m 14.22 arcane_orb,if=buff.arcane_charge.stack=0
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
n 6.10 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
o 155.55 arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
0.00 arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
p 58.69 arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
q 0.45 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.shared_cds
# count action,conditions
r 2.84 use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
s 3.56 use_items,if=buff.arcane_power.up
t 1.49 potion,if=buff.arcane_power.up
u 1.99 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
0.00 lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
v 2.00 berserking,if=buff.arcane_power.up
0.00 blood_fury,if=buff.arcane_power.up
0.00 fireblood,if=buff.arcane_power.up
0.00 ancestral_call,if=buff.arcane_power.up

Sample Sequence

045789ABDGHILMNPQRVXYjukstvpmpoooopoooopoooolpoooropoooopmpooonopoooopmpoooopoooopojlpoooopmpoooopoooopnmpoojlpoooopooookspmpoooopoooopooonopjlpmpooooproooopoooopmpoooopooonopjlpmpoooopoooopooooksvpmpoooopoooopnjlpmpoooopoooopoooopmupoooopoooopooonropjlpmpoooopoooopooqoopmpooookspoooopotooopjlpmpoooopoonoopmpoooopoojlpoooop

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 prepull_evo Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat 4 have_opened Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat 5 have_opened Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat 7 final_burn Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat 8 rs_max_delay Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat 9 ap_max_delay Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat A rop_max_delay Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat B totm_max_delay Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat D totm_max_delay Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat G barrage_mana_pct Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat H barrage_mana_pct Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat I ap_minimum_mana_pct Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat L totm_max_charges Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat M aoe_totm_max_charges Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat N am_spam Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat P am_spam_evo_pct Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat Q flask NightFae_Dream 67365.7/67366: 100% mana
Pre precombat R food NightFae_Dream 67365.7/67366: 100% mana
Pre precombat V conjure_mana_gem Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat X mirror_image Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat Y frostbolt Fluffy_Pillow 67365.7/67366: 100% mana
0:00.000 aoe j touch_of_the_magi Fluffy_Pillow 66365.7/67366: 99% mana
0:01.300 shared_cds u time_warp Fluffy_Pillow 64872.5/67366: 96% mana bloodlust, arcane_charge(4), crimson_chorus
0:01.300 aoe k arcane_power Fluffy_Pillow 62872.5/67366: 93% mana bloodlust, arcane_charge(4), temporal_warp, crimson_chorus
0:01.300 shared_cds s use_items Fluffy_Pillow 62872.5/67366: 93% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, crimson_chorus
0:01.300 shared_cds t potion Fluffy_Pillow 62872.5/67366: 93% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, crimson_chorus, gladiators_badge
0:01.300 shared_cds v berserking Fluffy_Pillow 62872.5/67366: 93% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:01.300 aoe p arcane_barrage Fluffy_Pillow 62872.5/67366: 93% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:02.055 aoe m arcane_orb Fluffy_Pillow 66584.3/67366: 99% mana bloodlust, berserking, arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:02.811 aoe p arcane_barrage Fluffy_Pillow 67352.9/67366: 100% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:03.566 aoe o arcane_explosion Fluffy_Pillow 67365.7/67366: 100% mana bloodlust, berserking, arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:04.321 aoe o arcane_explosion Fluffy_Pillow 65882.9/67366: 98% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:05.075 aoe o arcane_explosion Fluffy_Pillow 64398.8/67366: 96% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:05.830 aoe o arcane_explosion Fluffy_Pillow 62916.0/67366: 93% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:06.584 aoe p arcane_barrage Fluffy_Pillow 61431.9/67366: 91% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:07.339 aoe o arcane_explosion Fluffy_Pillow 65143.8/67366: 97% mana bloodlust, berserking, arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:08.094 aoe o arcane_explosion Fluffy_Pillow 63661.0/67366: 95% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:08.850 aoe o arcane_explosion Fluffy_Pillow 62179.6/67366: 92% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:09.605 aoe o arcane_explosion Fluffy_Pillow 60696.8/67366: 90% mana bloodlust, berserking, arcane_charge(3), arcane_power, clearcasting, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:10.362 aoe p arcane_barrage Fluffy_Pillow 61716.7/67366: 92% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:11.118 aoe o arcane_explosion Fluffy_Pillow 65429.9/67366: 97% mana bloodlust, berserking, arcane_power, rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:11.871 aoe o arcane_explosion Fluffy_Pillow 63944.4/67366: 95% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:12.625 aoe o arcane_explosion Fluffy_Pillow 62460.3/67366: 93% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:13.379 aoe o arcane_explosion Fluffy_Pillow 60976.2/67366: 91% mana bloodlust, arcane_charge(3), arcane_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:14.152 aoe l rune_of_power Fluffy_Pillow 59517.6/67366: 88% mana bloodlust, arcane_charge(4), arcane_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:14.922 aoe p arcane_barrage Fluffy_Pillow 60555.1/67366: 90% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:15.692 aoe o arcane_explosion Fluffy_Pillow 64287.1/67366: 95% mana bloodlust, arcane_power, rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:16.462 aoe o arcane_explosion Fluffy_Pillow 62824.6/67366: 93% mana bloodlust, arcane_charge, rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation
0:17.235 aoe o arcane_explosion Fluffy_Pillow 58866.0/67366: 87% mana bloodlust, arcane_charge(2), rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation
0:18.006 shared_cds r use_mana_gem NightFae_Dream 54904.8/67366: 82% mana bloodlust, arcane_charge(3), clearcasting, rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation
0:18.006 aoe o arcane_explosion Fluffy_Pillow 61641.4/67366: 92% mana bloodlust, arcane_charge(3), clearcasting, rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation
0:18.777 aoe p arcane_barrage Fluffy_Pillow 62680.2/67366: 93% mana bloodlust, arcane_charge(4), rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation
0:19.547 aoe o arcane_explosion Fluffy_Pillow 66412.2/67366: 99% mana bloodlust, rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation
0:20.318 aoe o arcane_explosion Fluffy_Pillow 62451.0/67366: 93% mana bloodlust, arcane_charge, rune_of_power, temporal_warp, crimson_chorus(3), potion_of_deathly_fixation
0:21.088 aoe o arcane_explosion Fluffy_Pillow 58488.4/67366: 87% mana bloodlust, arcane_charge(2), rune_of_power, temporal_warp, crimson_chorus(3), potion_of_deathly_fixation
0:21.857 aoe o arcane_explosion Fluffy_Pillow 54524.5/67366: 81% mana bloodlust, arcane_charge(3), rune_of_power, temporal_warp, crimson_chorus(3), potion_of_deathly_fixation
0:22.626 aoe p arcane_barrage Fluffy_Pillow 50560.6/67366: 75% mana bloodlust, arcane_charge(4), rune_of_power, temporal_warp, crimson_chorus(3), potion_of_deathly_fixation
0:23.396 aoe m arcane_orb Fluffy_Pillow 54292.7/67366: 81% mana bloodlust, rune_of_power, temporal_warp, crimson_chorus(3), potion_of_deathly_fixation
0:24.166 aoe p arcane_barrage Fluffy_Pillow 54830.1/67366: 81% mana bloodlust, arcane_charge(4), rune_of_power, temporal_warp, crimson_chorus(3), potion_of_deathly_fixation
0:24.934 aoe o arcane_explosion Fluffy_Pillow 58559.5/67366: 87% mana bloodlust, rune_of_power, temporal_warp, crimson_chorus(3), potion_of_deathly_fixation
0:25.704 aoe o arcane_explosion Fluffy_Pillow 54596.9/67366: 81% mana bloodlust, arcane_charge, rune_of_power, temporal_warp, crimson_chorus(3), potion_of_deathly_fixation
0:26.476 aoe o arcane_explosion Fluffy_Pillow 50637.0/67366: 75% mana bloodlust, arcane_charge(2), clearcasting, rune_of_power, temporal_warp, crimson_chorus(3)
0:27.248 aoe n shifting_power Fluffy_Pillow 51677.2/67366: 77% mana bloodlust, arcane_charge(3), temporal_warp, crimson_chorus(3)
0:29.484 aoe o arcane_explosion Fluffy_Pillow 52189.7/67366: 77% mana bloodlust, arcane_charge(3), temporal_warp, crimson_chorus(3)
0:30.255 aoe p arcane_barrage Fluffy_Pillow 48228.5/67366: 72% mana bloodlust, arcane_charge(4), temporal_warp, crimson_chorus(3)
0:31.023 aoe o arcane_explosion Fluffy_Pillow 51957.9/67366: 77% mana bloodlust, temporal_warp
0:31.793 aoe o arcane_explosion Fluffy_Pillow 47995.3/67366: 71% mana bloodlust, arcane_charge, clearcasting, temporal_warp
0:32.563 aoe o arcane_explosion Fluffy_Pillow 49032.8/67366: 73% mana bloodlust, arcane_charge(2), temporal_warp
0:33.334 aoe o arcane_explosion Fluffy_Pillow 45071.5/67366: 67% mana bloodlust, arcane_charge(3), temporal_warp
0:34.105 aoe p arcane_barrage Fluffy_Pillow 41110.3/67366: 61% mana bloodlust, arcane_charge(4), temporal_warp
0:34.875 aoe m arcane_orb Fluffy_Pillow 44842.4/67366: 67% mana bloodlust, temporal_warp
0:35.646 aoe p arcane_barrage Fluffy_Pillow 45381.2/67366: 67% mana bloodlust, arcane_charge(4), temporal_warp
0:36.418 aoe o arcane_explosion Fluffy_Pillow 49115.9/67366: 73% mana bloodlust, temporal_warp
0:37.189 aoe o arcane_explosion Fluffy_Pillow 45154.7/67366: 67% mana bloodlust, arcane_charge, temporal_warp
0:37.960 aoe o arcane_explosion Fluffy_Pillow 41193.5/67366: 61% mana bloodlust, arcane_charge(2), clearcasting, temporal_warp
0:38.731 aoe o arcane_explosion Fluffy_Pillow 42232.2/67366: 63% mana bloodlust, arcane_charge(3), temporal_warp
0:39.502 aoe p arcane_barrage Fluffy_Pillow 38271.0/67366: 57% mana bloodlust, arcane_charge(4), temporal_warp
0:40.273 aoe o arcane_explosion Fluffy_Pillow 42004.4/67366: 62% mana bloodlust, temporal_warp
0:41.042 aoe o arcane_explosion Fluffy_Pillow 38040.5/67366: 56% mana arcane_charge, clearcasting, temporal_warp
0:42.043 aoe o arcane_explosion Fluffy_Pillow 39389.2/67366: 58% mana arcane_charge(2)
0:43.342 aoe o arcane_explosion Fluffy_Pillow 36139.3/67366: 54% mana arcane_charge(3)
0:44.643 aoe p arcane_barrage Fluffy_Pillow 32892.2/67366: 49% mana arcane_charge(4)
0:45.943 aoe o arcane_explosion Fluffy_Pillow 37338.3/67366: 55% mana
0:47.243 aoe j touch_of_the_magi Fluffy_Pillow 34089.8/67366: 51% mana arcane_charge
0:48.542 aoe l rune_of_power Fluffy_Pillow 33340.0/67366: 49% mana arcane_charge(4)
0:49.842 aoe p arcane_barrage Fluffy_Pillow 35091.5/67366: 52% mana arcane_charge(4), rune_of_power
0:51.143 aoe o arcane_explosion Fluffy_Pillow 39539.0/67366: 59% mana rune_of_power
0:52.444 aoe o arcane_explosion Fluffy_Pillow 36291.9/67366: 54% mana arcane_charge, rune_of_power
0:53.743 aoe o arcane_explosion Fluffy_Pillow 33042.0/67366: 49% mana arcane_charge(2), rune_of_power
0:55.042 aoe o arcane_explosion Fluffy_Pillow 29792.2/67366: 44% mana arcane_charge(3), rune_of_power
0:56.342 aoe p arcane_barrage Fluffy_Pillow 26543.7/67366: 39% mana arcane_charge(4), rune_of_power
0:57.642 aoe m arcane_orb Fluffy_Pillow 30989.8/67366: 46% mana rune_of_power
0:58.940 aoe p arcane_barrage Fluffy_Pillow 32238.6/67366: 48% mana arcane_charge(4), rune_of_power
1:00.238 aoe o arcane_explosion Fluffy_Pillow 36682.1/67366: 54% mana rune_of_power
1:01.538 aoe o arcane_explosion Fluffy_Pillow 33433.6/67366: 50% mana arcane_charge, rune_of_power
1:02.838 aoe o arcane_explosion Fluffy_Pillow 30185.1/67366: 45% mana arcane_charge(2), crimson_chorus
1:04.139 aoe o arcane_explosion Fluffy_Pillow 26938.0/67366: 40% mana arcane_charge(3), crimson_chorus
1:05.439 aoe p arcane_barrage Fluffy_Pillow 23689.5/67366: 35% mana arcane_charge(4), clearcasting, crimson_chorus
1:06.739 aoe o arcane_explosion Fluffy_Pillow 28135.6/67366: 42% mana clearcasting, crimson_chorus
1:08.038 aoe o arcane_explosion Fluffy_Pillow 29885.8/67366: 44% mana arcane_charge, crimson_chorus
1:09.338 aoe o arcane_explosion Fluffy_Pillow 26637.3/67366: 40% mana arcane_charge(2), crimson_chorus
1:10.637 aoe o arcane_explosion Fluffy_Pillow 23387.4/67366: 35% mana arcane_charge(3), crimson_chorus
1:11.937 aoe p arcane_barrage Fluffy_Pillow 20138.9/67366: 30% mana arcane_charge(4), crimson_chorus(2)
1:13.238 aoe n shifting_power Fluffy_Pillow 24586.4/67366: 36% mana crimson_chorus(2)
1:17.008 aoe m arcane_orb Fluffy_Pillow 27165.8/67366: 40% mana crimson_chorus(2)
1:18.308 aoe p arcane_barrage Fluffy_Pillow 28417.3/67366: 42% mana arcane_charge(4), crimson_chorus(2)
1:19.608 aoe o arcane_explosion Fluffy_Pillow 32863.4/67366: 49% mana crimson_chorus(2)
1:20.909 aoe o arcane_explosion Fluffy_Pillow 29616.3/67366: 44% mana arcane_charge, crimson_chorus(2)
1:22.209 aoe j touch_of_the_magi Fluffy_Pillow 26367.8/67366: 39% mana arcane_charge(2), crimson_chorus(3)
1:23.510 aoe l rune_of_power Fluffy_Pillow 25620.7/67366: 38% mana arcane_charge(4), crimson_chorus(3)
1:24.808 aoe p arcane_barrage Fluffy_Pillow 27369.5/67366: 41% mana arcane_charge(4), rune_of_power, crimson_chorus(3)
1:26.108 aoe o arcane_explosion Fluffy_Pillow 31815.6/67366: 47% mana rune_of_power, crimson_chorus(3)
1:27.406 aoe o arcane_explosion Fluffy_Pillow 28564.4/67366: 42% mana arcane_charge, rune_of_power, crimson_chorus(3)
1:28.704 aoe o arcane_explosion Fluffy_Pillow 25313.2/67366: 38% mana arcane_charge(2), rune_of_power, crimson_chorus(3)
1:30.003 aoe o arcane_explosion Fluffy_Pillow 22063.4/67366: 33% mana arcane_charge(3), rune_of_power, crimson_chorus(3)
1:31.303 aoe p arcane_barrage Fluffy_Pillow 18814.9/67366: 28% mana arcane_charge(4), rune_of_power, crimson_chorus(3)
1:32.605 aoe o arcane_explosion Fluffy_Pillow 23263.7/67366: 35% mana rune_of_power
1:33.905 aoe o arcane_explosion Fluffy_Pillow 20015.3/67366: 30% mana arcane_charge, rune_of_power
1:35.205 aoe o arcane_explosion Fluffy_Pillow 16766.8/67366: 25% mana arcane_charge(2), rune_of_power
1:36.504 aoe o arcane_explosion Fluffy_Pillow 13516.9/67366: 20% mana arcane_charge(3), rune_of_power
1:37.803 aoe k arcane_power Fluffy_Pillow 10267.1/67366: 15% mana arcane_charge(4)
1:37.803 shared_cds s use_items Fluffy_Pillow 10267.1/67366: 15% mana arcane_charge(4), arcane_power, rune_of_power
1:37.803 aoe p arcane_barrage Fluffy_Pillow 10267.1/67366: 15% mana arcane_charge(4), arcane_power, rune_of_power, gladiators_badge
1:39.103 aoe m arcane_orb Fluffy_Pillow 14713.2/67366: 22% mana arcane_power, rune_of_power, gladiators_badge
1:40.402 aoe p arcane_barrage Fluffy_Pillow 16213.4/67366: 24% mana arcane_charge(4), arcane_power, rune_of_power, gladiators_badge
1:41.700 aoe o arcane_explosion Fluffy_Pillow 20656.8/67366: 31% mana arcane_power, rune_of_power, gladiators_badge
1:42.998 aoe o arcane_explosion Fluffy_Pillow 19905.6/67366: 30% mana arcane_charge, arcane_power, rune_of_power, gladiators_badge
1:44.297 aoe o arcane_explosion Fluffy_Pillow 19155.8/67366: 28% mana arcane_charge(2), arcane_power, rune_of_power, gladiators_badge
1:45.598 aoe o arcane_explosion Fluffy_Pillow 18408.7/67366: 27% mana arcane_charge(3), arcane_power, rune_of_power, gladiators_badge
1:46.897 aoe p arcane_barrage Fluffy_Pillow 17658.8/67366: 26% mana arcane_charge(4), arcane_power, rune_of_power, gladiators_badge
1:48.197 aoe o arcane_explosion Fluffy_Pillow 22105.0/67366: 33% mana arcane_power, rune_of_power, gladiators_badge
1:49.497 aoe o arcane_explosion Fluffy_Pillow 21356.5/67366: 32% mana arcane_charge, arcane_power, rune_of_power, gladiators_badge
1:50.795 aoe o arcane_explosion Fluffy_Pillow 20605.3/67366: 31% mana arcane_charge(2), arcane_power, clearcasting, gladiators_badge
1:52.094 aoe o arcane_explosion Fluffy_Pillow 22355.4/67366: 33% mana arcane_charge(3), arcane_power, gladiators_badge
1:53.392 aoe p arcane_barrage Fluffy_Pillow 21604.3/67366: 32% mana arcane_charge(4)
1:54.692 aoe o arcane_explosion Fluffy_Pillow 26050.4/67366: 39% mana
1:55.992 aoe o arcane_explosion Fluffy_Pillow 22801.9/67366: 34% mana arcane_charge
1:57.291 aoe o arcane_explosion Fluffy_Pillow 19552.1/67366: 29% mana arcane_charge(2)
1:58.593 aoe n shifting_power Fluffy_Pillow 16306.3/67366: 24% mana arcane_charge(3)
2:02.262 aoe o arcane_explosion Fluffy_Pillow 18749.6/67366: 28% mana arcane_charge(3), clearcasting, crimson_chorus
2:03.561 aoe p arcane_barrage Fluffy_Pillow 20499.7/67366: 30% mana arcane_charge(4), crimson_chorus
2:04.861 aoe j touch_of_the_magi Fluffy_Pillow 24945.9/67366: 37% mana crimson_chorus
2:06.159 aoe l rune_of_power Fluffy_Pillow 24194.7/67366: 36% mana arcane_charge(4), crimson_chorus
2:07.459 aoe p arcane_barrage Fluffy_Pillow 25946.2/67366: 39% mana arcane_charge(4), rune_of_power, crimson_chorus
2:08.758 aoe m arcane_orb Fluffy_Pillow 30391.0/67366: 45% mana rune_of_power, crimson_chorus
2:10.058 aoe p arcane_barrage Fluffy_Pillow 31642.5/67366: 47% mana arcane_charge(4), rune_of_power, crimson_chorus
2:11.356 aoe o arcane_explosion Fluffy_Pillow 36085.9/67366: 54% mana rune_of_power, crimson_chorus
2:12.656 aoe o arcane_explosion Fluffy_Pillow 32837.4/67366: 49% mana arcane_charge, rune_of_power, crimson_chorus(2)
2:13.955 aoe o arcane_explosion Fluffy_Pillow 29587.6/67366: 44% mana arcane_charge(2), rune_of_power, crimson_chorus(2)
2:15.256 aoe o arcane_explosion Fluffy_Pillow 26340.4/67366: 39% mana arcane_charge(3), rune_of_power, crimson_chorus(2)
2:16.555 aoe p arcane_barrage Fluffy_Pillow 23090.6/67366: 34% mana arcane_charge(4), rune_of_power, crimson_chorus(2)
2:17.855 shared_cds r use_mana_gem NightFae_Dream 27536.7/67366: 41% mana rune_of_power, crimson_chorus(2)
2:18.006 aoe o arcane_explosion Fluffy_Pillow 34476.8/67366: 51% mana rune_of_power, crimson_chorus(2)
2:19.305 aoe o arcane_explosion Fluffy_Pillow 31226.9/67366: 46% mana arcane_charge, rune_of_power, crimson_chorus(2)
2:20.605 aoe o arcane_explosion Fluffy_Pillow 27978.4/67366: 42% mana arcane_charge(2), crimson_chorus(2)
2:21.905 aoe o arcane_explosion Fluffy_Pillow 24729.9/67366: 37% mana arcane_charge(3), crimson_chorus(2)
2:23.203 aoe p arcane_barrage Fluffy_Pillow 21478.8/67366: 32% mana arcane_charge(4), clearcasting, crimson_chorus(3)
2:24.503 aoe o arcane_explosion Fluffy_Pillow 25924.9/67366: 38% mana clearcasting, crimson_chorus(3)
2:25.801 aoe o arcane_explosion Fluffy_Pillow 27673.7/67366: 41% mana arcane_charge, crimson_chorus(3)
2:27.101 aoe o arcane_explosion Fluffy_Pillow 24425.2/67366: 36% mana arcane_charge(2), crimson_chorus(3)
2:28.401 aoe o arcane_explosion Fluffy_Pillow 21176.7/67366: 31% mana arcane_charge(3), crimson_chorus(3)
2:29.699 aoe p arcane_barrage Fluffy_Pillow 17925.5/67366: 27% mana arcane_charge(4), crimson_chorus(3)
2:30.999 aoe m arcane_orb Fluffy_Pillow 22371.7/67366: 33% mana crimson_chorus(3)
2:32.298 aoe p arcane_barrage Fluffy_Pillow 23621.8/67366: 35% mana arcane_charge(4)
2:33.599 aoe o arcane_explosion Fluffy_Pillow 28069.3/67366: 42% mana
2:34.897 aoe o arcane_explosion Fluffy_Pillow 24818.1/67366: 37% mana arcane_charge, clearcasting
2:36.196 aoe o arcane_explosion Fluffy_Pillow 26568.3/67366: 39% mana arcane_charge(2)
2:37.497 aoe o arcane_explosion Fluffy_Pillow 23321.1/67366: 35% mana arcane_charge(3)
2:38.797 aoe p arcane_barrage Fluffy_Pillow 20072.7/67366: 30% mana arcane_charge(4)
2:40.096 aoe o arcane_explosion Fluffy_Pillow 24517.4/67366: 36% mana
2:41.395 aoe o arcane_explosion Fluffy_Pillow 21267.6/67366: 32% mana arcane_charge
2:42.693 aoe o arcane_explosion Fluffy_Pillow 18016.4/67366: 27% mana arcane_charge(2)
2:43.991 aoe n shifting_power Fluffy_Pillow 14765.2/67366: 22% mana arcane_charge(3)
2:47.695 aoe o arcane_explosion Fluffy_Pillow 17255.7/67366: 26% mana arcane_charge(3)
2:48.996 aoe p arcane_barrage Fluffy_Pillow 14008.5/67366: 21% mana arcane_charge(4)
2:50.295 aoe j touch_of_the_magi Fluffy_Pillow 18453.3/67366: 27% mana
2:51.596 aoe l rune_of_power Fluffy_Pillow 17706.2/67366: 26% mana arcane_charge(4)
2:52.896 aoe p arcane_barrage Fluffy_Pillow 19457.7/67366: 29% mana arcane_charge(4), rune_of_power
2:54.196 aoe m arcane_orb Fluffy_Pillow 23903.8/67366: 35% mana rune_of_power
2:55.496 aoe p arcane_barrage Fluffy_Pillow 25155.3/67366: 37% mana arcane_charge(4), rune_of_power
2:56.793 aoe o arcane_explosion Fluffy_Pillow 29597.4/67366: 44% mana rune_of_power
2:58.094 aoe o arcane_explosion Fluffy_Pillow 26350.3/67366: 39% mana arcane_charge, rune_of_power
2:59.392 aoe o arcane_explosion Fluffy_Pillow 23099.1/67366: 34% mana arcane_charge(2), clearcasting, rune_of_power
3:00.691 aoe o arcane_explosion Fluffy_Pillow 24849.3/67366: 37% mana arcane_charge(3), rune_of_power
3:01.990 aoe p arcane_barrage Fluffy_Pillow 21599.4/67366: 32% mana arcane_charge(4), rune_of_power
3:03.290 aoe o arcane_explosion Fluffy_Pillow 26045.6/67366: 39% mana rune_of_power, crimson_chorus
3:04.588 aoe o arcane_explosion Fluffy_Pillow 22794.4/67366: 34% mana arcane_charge, rune_of_power, crimson_chorus
3:05.890 aoe o arcane_explosion Fluffy_Pillow 19548.6/67366: 29% mana arcane_charge(2), crimson_chorus
3:07.190 aoe o arcane_explosion Fluffy_Pillow 16300.1/67366: 24% mana arcane_charge(3), crimson_chorus
3:08.490 aoe p arcane_barrage Fluffy_Pillow 13051.6/67366: 19% mana arcane_charge(4), crimson_chorus
3:09.789 aoe o arcane_explosion Fluffy_Pillow 17496.4/67366: 26% mana crimson_chorus
3:11.088 aoe o arcane_explosion Fluffy_Pillow 14246.6/67366: 21% mana arcane_charge, crimson_chorus
3:12.389 aoe o arcane_explosion Fluffy_Pillow 10999.4/67366: 16% mana arcane_charge(2), crimson_chorus
3:13.688 aoe o arcane_explosion Fluffy_Pillow 7749.6/67366: 12% mana arcane_charge(3), clearcasting, crimson_chorus(2)
3:14.987 aoe k arcane_power Fluffy_Pillow 9499.7/67366: 14% mana arcane_charge(4), crimson_chorus(2)
3:14.987 shared_cds s use_items Fluffy_Pillow 9499.7/67366: 14% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2)
3:14.987 shared_cds v berserking Fluffy_Pillow 9499.7/67366: 14% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
3:14.987 aoe p arcane_barrage Fluffy_Pillow 9499.7/67366: 14% mana berserking, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
3:16.170 aoe m arcane_orb Fluffy_Pillow 13788.2/67366: 20% mana berserking, arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
3:17.352 aoe p arcane_barrage Fluffy_Pillow 15130.8/67366: 22% mana berserking, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
3:18.536 aoe o arcane_explosion Fluffy_Pillow 19420.6/67366: 29% mana berserking, arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
3:19.720 aoe o arcane_explosion Fluffy_Pillow 18515.8/67366: 27% mana berserking, arcane_charge, arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
3:20.902 aoe o arcane_explosion Fluffy_Pillow 17608.4/67366: 26% mana berserking, arcane_charge(2), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
3:22.084 aoe o arcane_explosion Fluffy_Pillow 16700.9/67366: 25% mana berserking, arcane_charge(3), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
3:23.265 aoe p arcane_barrage Fluffy_Pillow 15792.1/67366: 23% mana berserking, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
3:24.449 aoe o arcane_explosion Fluffy_Pillow 20081.9/67366: 30% mana berserking, arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
3:25.631 aoe o arcane_explosion Fluffy_Pillow 19174.4/67366: 28% mana berserking, arcane_charge, arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
3:26.813 aoe o arcane_explosion Fluffy_Pillow 18267.0/67366: 27% mana berserking, arcane_charge(2), arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
3:27.995 aoe o arcane_explosion Fluffy_Pillow 17359.5/67366: 26% mana arcane_charge(3), arcane_power, crimson_chorus(3), gladiators_badge
3:29.296 aoe p arcane_barrage Fluffy_Pillow 16612.3/67366: 25% mana arcane_charge(4), arcane_power, clearcasting, crimson_chorus(3), gladiators_badge
3:30.595 aoe n shifting_power Fluffy_Pillow 21057.1/67366: 31% mana clearcasting, crimson_chorus(3)
3:34.310 aoe j touch_of_the_magi Fluffy_Pillow 23562.4/67366: 35% mana clearcasting
3:35.610 aoe l rune_of_power Fluffy_Pillow 22813.9/67366: 34% mana arcane_charge(4), clearcasting
3:36.911 aoe p arcane_barrage Fluffy_Pillow 24566.8/67366: 36% mana arcane_charge(4), clearcasting, rune_of_power
3:38.211 aoe m arcane_orb Fluffy_Pillow 29012.9/67366: 43% mana clearcasting, rune_of_power
3:39.512 aoe p arcane_barrage Fluffy_Pillow 30265.8/67366: 45% mana arcane_charge(4), clearcasting, rune_of_power
3:40.812 aoe o arcane_explosion Fluffy_Pillow 34711.9/67366: 52% mana clearcasting, rune_of_power
3:42.111 aoe o arcane_explosion Fluffy_Pillow 36462.1/67366: 54% mana arcane_charge, rune_of_power
3:43.411 aoe o arcane_explosion Fluffy_Pillow 33213.6/67366: 49% mana arcane_charge(2), rune_of_power
3:44.711 aoe o arcane_explosion Fluffy_Pillow 29965.1/67366: 44% mana arcane_charge(3), rune_of_power
3:46.011 aoe p arcane_barrage Fluffy_Pillow 26716.6/67366: 40% mana arcane_charge(4), rune_of_power
3:47.310 aoe o arcane_explosion Fluffy_Pillow 31161.4/67366: 46% mana rune_of_power
3:48.609 aoe o arcane_explosion Fluffy_Pillow 27911.5/67366: 41% mana arcane_charge, clearcasting, rune_of_power
3:49.909 aoe o arcane_explosion Fluffy_Pillow 29663.0/67366: 44% mana arcane_charge(2)
3:51.210 aoe o arcane_explosion Fluffy_Pillow 26415.9/67366: 39% mana arcane_charge(3)
3:52.509 aoe p arcane_barrage Fluffy_Pillow 23166.1/67366: 34% mana arcane_charge(4), clearcasting
3:53.807 aoe o arcane_explosion Fluffy_Pillow 27609.5/67366: 41% mana clearcasting
3:55.105 aoe o arcane_explosion Fluffy_Pillow 29358.3/67366: 44% mana arcane_charge
3:56.404 aoe o arcane_explosion Fluffy_Pillow 26108.5/67366: 39% mana arcane_charge(2)
3:57.704 aoe o arcane_explosion Fluffy_Pillow 22860.0/67366: 34% mana arcane_charge(3)
3:59.004 aoe p arcane_barrage Fluffy_Pillow 19611.5/67366: 29% mana arcane_charge(4), clearcasting
4:00.304 aoe m arcane_orb Fluffy_Pillow 24057.6/67366: 36% mana clearcasting
4:01.602 shared_cds u time_warp Fluffy_Pillow 25306.4/67366: 38% mana arcane_charge(4), clearcasting
4:01.602 aoe p arcane_barrage Fluffy_Pillow 23306.4/67366: 35% mana arcane_charge(4), clearcasting, temporal_warp
4:02.601 aoe o arcane_explosion Fluffy_Pillow 27347.0/67366: 41% mana clearcasting, temporal_warp
4:03.601 aoe o arcane_explosion Fluffy_Pillow 28694.4/67366: 43% mana arcane_charge, temporal_warp, crimson_chorus
4:04.602 aoe o arcane_explosion Fluffy_Pillow 25043.0/67366: 37% mana arcane_charge(2), temporal_warp, crimson_chorus
4:05.601 aoe o arcane_explosion Fluffy_Pillow 21389.0/67366: 32% mana arcane_charge(3), temporal_warp, crimson_chorus
4:06.603 aoe p arcane_barrage Fluffy_Pillow 17739.0/67366: 26% mana arcane_charge(4), temporal_warp, crimson_chorus
4:07.605 aoe o arcane_explosion Fluffy_Pillow 21783.6/67366: 32% mana temporal_warp, crimson_chorus
4:08.605 aoe o arcane_explosion Fluffy_Pillow 18130.9/67366: 27% mana arcane_charge, temporal_warp, crimson_chorus
4:09.607 aoe o arcane_explosion Fluffy_Pillow 14481.0/67366: 21% mana arcane_charge(2), temporal_warp, crimson_chorus
4:10.607 aoe o arcane_explosion Fluffy_Pillow 10828.3/67366: 16% mana arcane_charge(3), clearcasting, temporal_warp, crimson_chorus
4:11.608 aoe p arcane_barrage Fluffy_Pillow 12176.9/67366: 18% mana arcane_charge(4), temporal_warp, crimson_chorus
4:12.610 aoe o arcane_explosion Fluffy_Pillow 16221.6/67366: 24% mana temporal_warp, crimson_chorus(2)
4:13.610 aoe o arcane_explosion Fluffy_Pillow 12568.9/67366: 19% mana arcane_charge, clearcasting, temporal_warp, crimson_chorus(2)
4:14.611 aoe o arcane_explosion Fluffy_Pillow 13917.5/67366: 21% mana arcane_charge(2), temporal_warp, crimson_chorus(2)
4:15.610 aoe n shifting_power Fluffy_Pillow 10263.5/67366: 15% mana arcane_charge(3), temporal_warp, crimson_chorus(2)
4:18.595 shared_cds r use_mana_gem NightFae_Dream 11785.2/67366: 17% mana arcane_charge(3), temporal_warp, crimson_chorus(2)
4:18.595 aoe o arcane_explosion Fluffy_Pillow 18521.8/67366: 27% mana arcane_charge(3), temporal_warp, crimson_chorus(2)
4:19.597 aoe p arcane_barrage Fluffy_Pillow 14871.8/67366: 22% mana arcane_charge(4), temporal_warp, crimson_chorus(2)
4:20.596 aoe j touch_of_the_magi Fluffy_Pillow 18912.4/67366: 28% mana temporal_warp, crimson_chorus(2)
4:21.596 aoe l rune_of_power Fluffy_Pillow 17759.7/67366: 26% mana arcane_charge(4), temporal_warp, crimson_chorus(2)
4:22.595 aoe p arcane_barrage Fluffy_Pillow 19105.7/67366: 28% mana arcane_charge(4), rune_of_power, temporal_warp, crimson_chorus(2)
4:23.594 aoe m arcane_orb Fluffy_Pillow 23146.3/67366: 34% mana rune_of_power, temporal_warp, crimson_chorus(3)
4:24.594 aoe p arcane_barrage Fluffy_Pillow 23993.6/67366: 36% mana arcane_charge(4), rune_of_power, temporal_warp, crimson_chorus(3)
4:25.594 aoe o arcane_explosion Fluffy_Pillow 28035.6/67366: 42% mana rune_of_power, temporal_warp, crimson_chorus(3)
4:26.596 aoe o arcane_explosion Fluffy_Pillow 24385.6/67366: 36% mana arcane_charge, rune_of_power, temporal_warp, crimson_chorus(3)
4:27.596 aoe o arcane_explosion Fluffy_Pillow 20732.9/67366: 31% mana arcane_charge(2), rune_of_power, temporal_warp, crimson_chorus(3)
4:28.597 aoe o arcane_explosion Fluffy_Pillow 17081.5/67366: 25% mana arcane_charge(3), rune_of_power, temporal_warp, crimson_chorus(3)
4:29.597 aoe p arcane_barrage Fluffy_Pillow 13428.9/67366: 20% mana arcane_charge(4), rune_of_power, temporal_warp, crimson_chorus(3)
4:30.598 aoe o arcane_explosion Fluffy_Pillow 17472.1/67366: 26% mana rune_of_power, temporal_warp, crimson_chorus(3)
4:31.599 aoe o arcane_explosion Fluffy_Pillow 13820.8/67366: 21% mana arcane_charge, rune_of_power, temporal_warp, crimson_chorus(3)
4:32.599 aoe o arcane_explosion Fluffy_Pillow 10168.1/67366: 15% mana arcane_charge(2), rune_of_power, temporal_warp, crimson_chorus(3)
4:33.600 aoe o arcane_explosion Fluffy_Pillow 6516.8/67366: 10% mana arcane_charge(3), clearcasting, rune_of_power, temporal_warp
4:34.601 aoe p arcane_barrage Fluffy_Pillow 7865.4/67366: 12% mana arcane_charge(4), temporal_warp
4:35.601 aoe o arcane_explosion Fluffy_Pillow 11907.4/67366: 18% mana temporal_warp
4:36.604 aoe o arcane_explosion Fluffy_Pillow 8258.7/67366: 12% mana arcane_charge, temporal_warp
4:37.605 aoe q evocation NightFae_Dream 4607.4/67366: 7% mana arcane_charge(2), temporal_warp
4:40.931 aoe o arcane_explosion Fluffy_Pillow 61831.6/67366: 92% mana arcane_charge(2), temporal_warp
4:41.931 aoe o arcane_explosion Fluffy_Pillow 58179.0/67366: 86% mana arcane_charge(3)
4:43.229 aoe p arcane_barrage Fluffy_Pillow 54927.8/67366: 82% mana arcane_charge(4), clearcasting
4:44.528 aoe m arcane_orb Fluffy_Pillow 59372.6/67366: 88% mana clearcasting
4:45.828 aoe p arcane_barrage Fluffy_Pillow 60624.1/67366: 90% mana arcane_charge(4), clearcasting
4:47.127 aoe o arcane_explosion Fluffy_Pillow 65068.9/67366: 97% mana clearcasting
4:48.427 aoe o arcane_explosion Fluffy_Pillow 66820.4/67366: 99% mana arcane_charge
4:49.726 aoe o arcane_explosion Fluffy_Pillow 63570.5/67366: 94% mana arcane_charge(2)
4:51.026 aoe o arcane_explosion Fluffy_Pillow 60322.0/67366: 90% mana arcane_charge(3)
4:52.325 aoe k arcane_power Fluffy_Pillow 57072.2/67366: 85% mana arcane_charge(4), clearcasting
4:52.325 shared_cds s use_items Fluffy_Pillow 57072.2/67366: 85% mana arcane_charge(4), arcane_power, clearcasting, rune_of_power
4:52.325 aoe p arcane_barrage Fluffy_Pillow 57072.2/67366: 85% mana arcane_charge(4), arcane_power, clearcasting, rune_of_power, gladiators_badge
4:53.625 aoe o arcane_explosion Fluffy_Pillow 61518.3/67366: 91% mana arcane_power, clearcasting, rune_of_power, gladiators_badge
4:54.926 aoe o arcane_explosion Fluffy_Pillow 63271.2/67366: 94% mana arcane_charge, arcane_power, rune_of_power, gladiators_badge
4:56.227 aoe o arcane_explosion Fluffy_Pillow 62524.0/67366: 93% mana arcane_charge(2), arcane_power, rune_of_power, gladiators_badge
4:57.528 aoe o arcane_explosion Fluffy_Pillow 61776.9/67366: 92% mana arcane_charge(3), arcane_power, rune_of_power, gladiators_badge
4:58.827 aoe p arcane_barrage Fluffy_Pillow 61027.1/67366: 91% mana arcane_charge(4), arcane_power, rune_of_power, gladiators_badge
5:00.126 aoe o arcane_explosion Fluffy_Pillow 65471.9/67366: 97% mana arcane_power, rune_of_power, gladiators_badge
5:01.426 shared_cds t potion Fluffy_Pillow 64723.4/67366: 96% mana arcane_charge, arcane_power, clearcasting, rune_of_power, gladiators_badge
5:01.426 aoe o arcane_explosion Fluffy_Pillow 64723.4/67366: 96% mana arcane_charge, arcane_power, clearcasting, rune_of_power, potion_of_deathly_fixation, gladiators_badge
5:02.727 aoe o arcane_explosion Fluffy_Pillow 66476.2/67366: 99% mana arcane_charge(2), arcane_power, rune_of_power, potion_of_deathly_fixation, gladiators_badge
5:04.027 aoe o arcane_explosion Fluffy_Pillow 65727.7/67366: 98% mana arcane_charge(3), arcane_power, clearcasting, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
5:05.326 aoe p arcane_barrage Fluffy_Pillow 67365.7/67366: 100% mana arcane_charge(4), arcane_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
5:06.625 aoe j touch_of_the_magi Fluffy_Pillow 67365.7/67366: 100% mana arcane_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
5:07.923 aoe l rune_of_power Fluffy_Pillow 64869.8/67366: 96% mana arcane_charge(4), crimson_chorus, potion_of_deathly_fixation
5:09.222 aoe p arcane_barrage Fluffy_Pillow 66619.9/67366: 99% mana arcane_charge(4), rune_of_power, crimson_chorus, potion_of_deathly_fixation
5:10.520 aoe m arcane_orb Fluffy_Pillow 67365.7/67366: 100% mana rune_of_power, crimson_chorus, potion_of_deathly_fixation
5:11.817 aoe p arcane_barrage Fluffy_Pillow 67365.7/67366: 100% mana arcane_charge(4), rune_of_power, crimson_chorus, potion_of_deathly_fixation
5:13.116 aoe o arcane_explosion Fluffy_Pillow 67365.7/67366: 100% mana rune_of_power, crimson_chorus(2), potion_of_deathly_fixation
5:14.417 aoe o arcane_explosion Fluffy_Pillow 64118.6/67366: 95% mana arcane_charge, rune_of_power, crimson_chorus(2), potion_of_deathly_fixation
5:15.716 aoe o arcane_explosion Fluffy_Pillow 60868.7/67366: 90% mana arcane_charge(2), rune_of_power, crimson_chorus(2), potion_of_deathly_fixation
5:17.015 aoe o arcane_explosion Fluffy_Pillow 57618.9/67366: 86% mana arcane_charge(3), rune_of_power, crimson_chorus(2), potion_of_deathly_fixation
5:18.315 aoe p arcane_barrage Fluffy_Pillow 54370.4/67366: 81% mana arcane_charge(4), rune_of_power, crimson_chorus(2), potion_of_deathly_fixation
5:19.614 aoe o arcane_explosion Fluffy_Pillow 58815.2/67366: 87% mana rune_of_power, crimson_chorus(2), potion_of_deathly_fixation
5:20.914 aoe o arcane_explosion Fluffy_Pillow 55566.7/67366: 82% mana arcane_charge, clearcasting, rune_of_power, crimson_chorus(2), potion_of_deathly_fixation
5:22.213 aoe n shifting_power Fluffy_Pillow 57316.9/67366: 85% mana arcane_charge(2), crimson_chorus(2), potion_of_deathly_fixation
5:25.948 aoe o arcane_explosion Fluffy_Pillow 59849.1/67366: 89% mana arcane_charge(2), crimson_chorus(3), potion_of_deathly_fixation
5:27.246 aoe o arcane_explosion Fluffy_Pillow 56597.9/67366: 84% mana arcane_charge(3), crimson_chorus(3)
5:28.545 aoe p arcane_barrage Fluffy_Pillow 53348.1/67366: 79% mana arcane_charge(4), crimson_chorus(3)
5:29.844 aoe m arcane_orb Fluffy_Pillow 57792.8/67366: 86% mana crimson_chorus(3)
5:31.144 aoe p arcane_barrage Fluffy_Pillow 59044.4/67366: 88% mana arcane_charge(4), crimson_chorus(3)
5:32.445 aoe o arcane_explosion Fluffy_Pillow 63491.8/67366: 94% mana crimson_chorus(3)
5:33.745 aoe o arcane_explosion Fluffy_Pillow 60243.3/67366: 89% mana arcane_charge
5:35.045 aoe o arcane_explosion Fluffy_Pillow 56994.9/67366: 85% mana arcane_charge(2)
5:36.346 aoe o arcane_explosion Fluffy_Pillow 53747.7/67366: 80% mana arcane_charge(3), clearcasting
5:37.644 aoe p arcane_barrage Fluffy_Pillow 55496.5/67366: 82% mana arcane_charge(4)
5:38.944 aoe o arcane_explosion Fluffy_Pillow 59942.7/67366: 89% mana
5:40.245 aoe o arcane_explosion Fluffy_Pillow 56695.5/67366: 84% mana arcane_charge
5:41.545 aoe j touch_of_the_magi Fluffy_Pillow 53447.0/67366: 79% mana arcane_charge(2), clearcasting
5:42.845 aoe l rune_of_power Fluffy_Pillow 52698.5/67366: 78% mana arcane_charge(4), clearcasting
5:44.145 aoe p arcane_barrage Fluffy_Pillow 54450.0/67366: 81% mana arcane_charge(4), clearcasting, rune_of_power
5:45.443 aoe o arcane_explosion Fluffy_Pillow 58893.5/67366: 87% mana clearcasting, rune_of_power
5:46.744 aoe o arcane_explosion Fluffy_Pillow 60646.3/67366: 90% mana arcane_charge, rune_of_power
5:48.044 aoe o arcane_explosion Fluffy_Pillow 57397.9/67366: 85% mana arcane_charge(2), clearcasting, rune_of_power
5:49.343 aoe o arcane_explosion Fluffy_Pillow 59148.0/67366: 88% mana arcane_charge(3), rune_of_power
5:50.643 aoe p arcane_barrage Fluffy_Pillow 55899.5/67366: 83% mana arcane_charge(4), rune_of_power

Stats

Level Bonus (60) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 198 1 199 199 0
Agility 306 2 308 308 0
Stamina 414 0 2013 1918 1504
Intellect 450 -3 1767 1588 1066 (46)
Spirit 0 0 0 0 0
Health 40260 38360 0
Mana 67366 67366 0
Spell Power 1767 1588 0
Crit 15.74% 15.74% 376
Haste 15.76% 15.76% 520
Versatility 7.97% 7.97% 319
Mana Regen 1347 1347 0
Mastery 34.73% 34.73% 733
Armor 369 369 369
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 227.00
Local Head Confidant's Favored Cap
ilevel: 226, stats: { 44 Armor, +82 Int, +149 Sta, +44 Haste, +98 Mastery }
Local Neck Noble's Birthstone Pendant
ilevel: 226, stats: { +84 Sta, +52 Crit, +162 Mastery }
Local Shoulders Shawl of the Penitent
ilevel: 233, stats: { 42 Armor, +65 Int, +122 Sta, +33 Crit, +76 Haste }
Local Chest Robes of the Cursed Commando
ilevel: 233, stats: { 61 Armor, +87 Int, +162 Sta, +47 Crit, +100 Haste }, enchant: { +20 Int }
Local Waist Cinch of Infinite Tightness
ilevel: 226, stats: { 33 Armor, +61 Int, +112 Sta, +69 Crit, +36 Vers }
Local Legs Courtier's Costume Trousers
ilevel: 226, stats: { 51 Armor, +82 Int, +149 Sta, +49 Vers, +93 Mastery }
Local Feet Slippers of the Forgotten Heretic
ilevel: 226, stats: { 36 Armor, +61 Int, +112 Sta, +73 Crit, +32 Mastery }
Local Wrists Acolyte's Velvet Bindings
ilevel: 226, stats: { 29 Armor, +46 Int, +84 Sta, +26 Vers, +53 Mastery }, enchant: { +15 Int }
Local Hands Impossibly Oversized Mitts
ilevel: 226, stats: { 33 Armor, +61 Int, +112 Sta, +31 Haste, +74 Mastery }
Local Finger1 Most Regal Signet of Sire Denathrius
ilevel: 233, stats: { +91 Sta, +178 Haste, +48 Mastery }, enchant: { +16 Mastery }
item effects: { equip: Denathrius' Privilege }
Local Finger2 Shadowghast Ring
ilevel: 235, stats: { +94 Sta, +115 Mastery, +115 Vers }, enchant: { +16 Mastery }
item effects: { equip: Temporal Warp }
Local Trinket1 Cabalist's Hymnal
ilevel: 226, stats: { +77 Int }
item effects: { equip: Crimson Chorus }
Local Trinket2 Sinful Aspirant's Badge of Ferocity
ilevel: 207, stats: { +91 Haste }
item effects: { use: Gladiator's Badge }
Local Back Mantle of Manifest Sins
ilevel: 226, stats: { 40 Armor, +84 Sta, +53 Crit, +26 Mastery, +46 StrAgiInt }
Local Main Hand Staff of the Penitent
ilevel: 226, weapon: { 93 - 128, 3.6 }, stats: { +82 Int, +281 Int, +149 Sta, +49 Crit, +93 Vers }, enchant: sinful_revelation

Profile

mage="NightFae_Dream"
source=default
spec=arcane
level=60
race=troll
role=spell
position=back
talents=1031021
talent_override=resonance,if=3>2
covenant=night_fae
soulbind=arcane_prodigy:6//51:6

# Default consumables
potion=deathly_fixation
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=variable,name=prepull_evo,op=reset,default=0
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
actions.precombat+=/variable,name=have_opened,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
actions.precombat+=/variable,name=final_burn,op=set,value=0
actions.precombat+=/variable,name=rs_max_delay,op=reset,default=5
actions.precombat+=/variable,name=ap_max_delay,op=reset,default=10
actions.precombat+=/variable,name=rop_max_delay,op=reset,default=20
actions.precombat+=/variable,name=totm_max_delay,op=reset,default=5
actions.precombat+=/variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
actions.precombat+=/variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
actions.precombat+=/variable,name=barrage_mana_pct,op=reset,default=70
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=reset,default=30
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
actions.precombat+=/variable,name=totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=aoe_totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=am_spam,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
actions.precombat+=/variable,name=am_spam_evo_pct,op=reset,default=15
actions.precombat+=/flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_familiar
actions.precombat+=/arcane_intellect
actions.precombat+=/conjure_mana_gem
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/frostbolt,if=variable.prepull_evo<=0
actions.precombat+=/evocation,if=variable.prepull_evo>0

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/call_action_list,name=shared_cds
actions+=/call_action_list,name=essences
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/call_action_list,name=opener,if=variable.have_opened<=0
actions+=/call_action_list,name=am_spam,if=variable.am_spam=1
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=rotation,if=variable.final_burn=0
actions+=/call_action_list,name=final_burn,if=variable.final_burn=1
actions+=/call_action_list,name=movement

actions.am_spam=cancel_action,if=action.evocation.channeling&mana.pct>=95
actions.am_spam+=/evocation,if=mana.pct<=variable.am_spam_evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/rune_of_power,if=buff.rune_of_power.down&cooldown.arcane_power.remains>0
actions.am_spam+=/touch_of_the_magi,if=(cooldown.arcane_power.remains=0&buff.rune_of_power.down)|prev_gcd.1.rune_of_power
actions.am_spam+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&buff.rune_of_power.down&essence.vision_of_perfection.enabled
actions.am_spam+=/arcane_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.ap_max_delay
actions.am_spam+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=action.arcane_missiles.execute_time&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_barrage,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_missiles,if=buff.clearcasting.react,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/arcane_missiles,if=!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.am_spam+=/arcane_barrage
actions.am_spam+=/arcane_blast

actions.aoe=frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
actions.aoe+=/arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
actions.aoe+=/mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
actions.aoe+=/arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
actions.aoe+=/rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
actions.aoe+=/presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
actions.aoe+=/arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
actions.aoe+=/supernova
actions.aoe+=/arcane_orb,if=buff.arcane_charge.stack=0
actions.aoe+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
actions.aoe+=/arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1

# Prioritize using grisly icicle with ap. Use it with totm otherwise.
actions.cooldowns=frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.cooldowns+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
# Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
# Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
actions.cooldowns+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
# Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
# Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
# Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
actions.cooldowns+=/arcane_power,if=(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
actions.cooldowns+=/rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
# Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
actions.cooldowns+=/presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
# Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.cooldowns+=/presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled

actions.essences=blood_of_the_enemy,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/blood_of_the_enemy,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains>=50&cooldown.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay
actions.essences+=/worldvein_resonance,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/guardian_of_azeroth,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/guardian_of_azeroth,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/concentrated_flame,line_cd=6,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/reaping_flames,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/focused_azerite_beam,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/purifying_blast,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/ripple_in_space,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/the_unbound_force,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/memory_of_lucid_dreams,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down

actions.final_burn=arcane_missiles,if=buff.clearcasting.react,chain=1
actions.final_burn+=/arcane_blast
actions.final_burn+=/arcane_barrage

actions.movement=blink_any,if=movement.distance>=10
actions.movement+=/presence_of_mind
actions.movement+=/arcane_missiles,if=movement.distance<10
actions.movement+=/arcane_orb
actions.movement+=/fire_blast

actions.opener=variable,name=have_opened,op=set,value=1,if=prev_gcd.1.evocation
actions.opener+=/fire_blast,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command_frost.up
actions.opener+=/frost_nova,if=runeforge.grisly_icicle.equipped&mana.pct>95
actions.opener+=/mirrors_of_torment
actions.opener+=/deathborne
actions.opener+=/radiant_spark,if=mana.pct>40
actions.opener+=/cancel_action,if=action.shifting_power.channeling&gcd.remains=0
actions.opener+=/shifting_power,if=soulbind.field_of_blossoms.enabled
actions.opener+=/touch_of_the_magi
actions.opener+=/arcane_power
actions.opener+=/rune_of_power,if=buff.rune_of_power.down
actions.opener+=/presence_of_mind
actions.opener+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.opener+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.opener+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.opener+=/arcane_missiles,if=buff.clearcasting.react,chain=1
actions.opener+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges&(cooldown.arcane_power.remains>10|active_enemies<=2)
actions.opener+=/arcane_blast,if=buff.rune_of_power.up|mana.pct>15
actions.opener+=/evocation,if=buff.rune_of_power.down,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.opener+=/arcane_barrage

actions.rotation=variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
actions.rotation+=/strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
actions.rotation+=/arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
actions.rotation+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.rotation+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.rotation+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
actions.rotation+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
actions.rotation+=/supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.rotation+=/arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
actions.rotation+=/arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_blast
actions.rotation+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.rotation+=/arcane_barrage

actions.shared_cds=use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
actions.shared_cds+=/use_items,if=buff.arcane_power.up
actions.shared_cds+=/potion,if=buff.arcane_power.up
actions.shared_cds+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
actions.shared_cds+=/lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/berserking,if=buff.arcane_power.up
actions.shared_cds+=/blood_fury,if=buff.arcane_power.up
actions.shared_cds+=/fireblood,if=buff.arcane_power.up
actions.shared_cds+=/ancestral_call,if=buff.arcane_power.up

head=confidants_favored_cap,id=183021,bonus_id=1498,ilevel=226
neck=nobles_birthstone_pendant,id=183039,bonus_id=1498,ilevel=226
shoulders=shawl_of_the_penitent,id=183020,bonus_id=1498,ilevel=233
back=mantle_of_manifest_sins,id=183033,bonus_id=1498,ilevel=226
chest=robes_of_the_cursed_commando,id=182998,bonus_id=1498,ilevel=233,enchant=eternal_insight
wrists=acolytes_velvet_bindings,id=183017,bonus_id=1498,ilevel=226,enchant=eternal_intellect
hands=impossibly_oversized_mitts,id=183022,bonus_id=1498,ilevel=226
waist=cinch_of_infinite_tightness,id=183028,bonus_id=1498,ilevel=226
legs=courtiers_costume_trousers,id=183011,bonus_id=1498,ilevel=226
feet=slippers_of_the_forgotten_heretic,id=182979,bonus_id=1498,ilevel=226
finger1=most_regal_signet_of_sire_denathrius,id=183036,bonus_id=1498,ilevel=233,enchant=16mastery
finger2=shadowghast_ring,id=178926,bonus_id=6648/6650/6758/6834/1532,ilevel=235,enchant=16mastery
trinket1=cabalists_hymnal,id=184028,bonus_id=1498,ilevel=226
trinket2=sinful_aspirants_badge_of_ferocity,id=175884,bonus_id=1521,ilevel=207
main_hand=staff_of_the_penitent,id=180000,bonus_id=7187/6652/1524,ilevel=226,enchant=sinful_revelation

# Gear Summary
# gear_ilvl=226.73
# gear_stamina=1504
# gear_intellect=1066
# gear_crit_rating=376
# gear_haste_rating=520
# gear_mastery_rating=733
# gear_versatility_rating=319
# gear_armor=369

NightFae_Dream_SB : 9109 dps, 3838 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
9109.1 9109.1 10.3 / 0.113% 759.8 / 8.3% 4.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
2084.1 1975.8 Mana 0.00% 52.9 100.0% 100%
Talents
Night Fae
Runeforge

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
NightFae_Dream_SB 9109
Arcane Barrage 3368 37.0% 58.7 5.12sec 17198 14988 Direct 175.8 4833 9742 5739 18.5%

Stats Details: Arcane Barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 58.68 175.85 0.00 0.00 1.1475 0.0000 1009255.27 1009255.27 0.00% 14988.12 14988.12
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.54% 143.38 105 179 4832.55 2155 14954 4834.46 4195 5355 692962 692962 0.00%
crit 18.46% 32.47 15 50 9742.06 4309 29907 9753.00 6760 13482 316293 316293 0.00%

Action Details: Arcane Barrage

  • id:44425
  • school:arcane
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.728000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=0 + 72.8%} Arcane damage. For each Arcane Charge, deals {$36032s2=30}% additional damage$?a321526[, grants you {$321526s1=2}% of your maximum mana,][]$?a231564[ and hits {$36032s3=0} additional nearby $Ltarget:targets; for {$s2=40}% of its damage][]. |cFFFFFFFFConsumes all Arcane Charges.|r

Action Priority List

    aoe
    [p]:58.68
  • if_expr:buff.arcane_charge.stack=buff.arcane_charge.max_stack
Arcane Explosion 3865 42.4% 155.6 1.91sec 7444 6529 Direct 466.9 2086 4197 2481 18.7%

Stats Details: Arcane Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 155.63 466.88 0.00 0.00 1.1401 0.0000 1158489.37 1158489.37 0.00% 6529.46 6529.46
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.30% 379.57 286 467 2086.47 1427 3962 2086.95 1973 2199 791995 791995 0.00%
crit 18.70% 87.32 52 125 4196.81 2855 7924 4199.30 3688 4879 366494 366494 0.00%

Action Details: Arcane Explosion

  • id:1449
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.502320
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s2=0 + 50.2%} Arcane damage to all enemies within $A2 yards.$?a137021[ |cFFFFFFFFGenerates {$s1=1} Arcane Charge if any targets are hit.|r][]

Action Priority List

    aoe
    [o]:155.65
  • if_expr:buff.arcane_charge.stack<buff.arcane_charge.max_stack
Arcane Orb 0 (736) 0.0% (8.1%) 14.2 21.65sec 15495 13420

Stats Details: Arcane Orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.21 0.00 0.00 0.00 1.1546 0.0000 0.00 0.00 0.00% 13420.22 13420.22

Action Details: Arcane Orb

  • id:153626
  • school:arcane
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:153626
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r

Action Priority List

    aoe
    [m]:14.21
  • if_expr:buff.arcane_charge.stack=0
    Arcane Orb (_bolt) 736 8.1% 42.6 21.64sec 5171 0 Direct 42.6 4346 8757 5170 18.7%

Stats Details: Arcane Orb Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 42.57 42.57 0.00 0.00 0.0000 0.0000 220145.36 220145.36 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.31% 34.62 23 48 4346.32 2821 7830 4350.55 3536 4865 150495 150495 0.00%
crit 18.69% 7.96 1 17 8757.17 5642 15661 8769.96 5720 14774 69650 69650 0.00%

Action Details: Arcane Orb Bolt

  • id:153640
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.092000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:153640
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:{$@spelldesc153626=Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r}
Deathly Fixation 0 (105) 0.0% (1.2%) 22.7 7.43sec 1397 0

Stats Details: Deathly Fixation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 22.71 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Deathly Fixation

  • id:322253
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:42.90
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322253
  • name:Deathly Fixation
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1.
  • description:Deal {$s1=43} Shadow damage every $t1. Stacks up to 5 times.
    Deathly Eruption 105 1.2% 22.7 7.43sec 1397 0 Direct 22.7 1156 2314 1397 20.8%

Stats Details: Deathly Eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 22.71 22.71 0.00 0.00 0.0000 0.0000 31735.22 31735.22 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.19% 17.98 7 32 1156.42 1117 1217 1156.32 1121 1202 20799 20799 0.00%
crit 20.81% 4.73 0 14 2314.26 2233 2433 2299.91 0 2433 10936 10936 0.00%

Action Details: Deathly Eruption

  • id:322256
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:984.99
  • base_dd_max:984.99
  • base_dd_mult:1.00

Spelldata

  • id:322256
  • name:Deathly Eruption
  • school:shadow
  • tooltip:
  • description:Deal {$s1=985} Shadow damage.
Eternal Insight 41 0.5% 22.0 13.71sec 559 0 Direct 22.0 471 941 559 18.8%

Stats Details: Eternal Insight

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 22.02 22.02 0.00 0.00 0.0000 0.0000 12315.12 12315.12 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.19% 17.88 7 30 470.69 453 494 470.67 460 485 8417 8417 0.00%
crit 18.81% 4.14 0 15 941.28 907 988 923.74 0 988 3899 3899 0.00%

Action Details: Eternal Insight

  • id:342314
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:400.00
  • base_dd_max:400.00
  • base_dd_mult:1.00

Spelldata

  • id:342314
  • name:Eternal Insight
  • school:shadow
  • tooltip:
  • description:Deals {$s1=400} Shadow damage.
Frostbolt 4 0.0% 0.0 0.00sec 0 0 Direct 1.0 1052 2104 1203 14.3%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 1.00 0.00 0.00 0.0000 0.0000 1202.90 1202.90 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 85.67% 0.86 0 1 1052.14 1052 1052 901.38 0 1052 901 901 0.00%
crit 14.33% 0.14 0 1 2104.27 2104 2104 301.52 0 2104 302 302 0.00%

Action Details: Frostbolt

  • id:116
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.511000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116
  • name:Frostbolt
  • school:frost
  • tooltip:
  • description:Launches a bolt of frost at the enemy, causing {$228597s1=0} Frost damage and slowing movement speed by {$205708s1=50}% for {$205708d=8 seconds}.
Mirror Image 0 (20) 0.0% (0.2%) 1.0 0.00sec 5776 0

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.
    Frostbolt (mirror_image) 144  / 20 0.2% 117.0 0.99sec 49 49 Direct 117.0 41 83 49 19.9%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 117.00 117.00 0.00 0.00 1.0091 0.0000 5775.55 5775.55 0.00% 48.92 48.92
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.12% 93.74 80 107 41.11 30 52 41.11 40 43 3854 3854 0.00%
crit 19.88% 23.26 10 37 82.64 59 104 82.65 71 93 1922 1922 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:40.00
Shifting Power 281 3.1% 6.1 48.04sec 13796 4120 Periodic 72.8 969 1937 1156 19.4% 2.1%

Stats Details: Shifting Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.10 0.00 24.26 72.79 3.3488 0.7789 84155.80 84155.80 0.00% 4119.63 4119.63
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.63% 58.70 40 79 968.60 949 1034 968.56 955 984 56851 56851 0.00%
crit 19.37% 14.10 2 27 1937.04 1898 2067 1937.01 1903 2002 27305 27305 0.00%

Action Details: Shifting Power

  • id:314791
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:4.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:314791
  • name:Shifting Power
  • school:nature
  • tooltip:Every $t1 sec, deal {$325130s1=0} Nature damage to enemies within $325130A1 yds and reduce the remaining cooldown of your abilities by ${-{$s2=3000}/1000} sec.
  • description:Draw power from the ground beneath, dealing ${{$325130s1=0}*{$d=4 seconds}/$t} Nature damage over {$d=4 seconds} to enemies within $325130A1 yds. While channeling, your Mage ability cooldowns are reduced by ${-{$s2=3000}/1000*{$d=4 seconds}/$t} sec over {$d=4 seconds}.

Action Details: Shifting Power Pulse

  • id:325130
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:18.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.473600
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:325130
  • name:Shifting Power
  • school:nature
  • tooltip:
  • description:{$@spelldesc314791=Draw power from the ground beneath, dealing ${{$325130s1=0}*{$d=4 seconds}/$t} Nature damage over {$d=4 seconds} to enemies within $325130A1 yds. While channeling, your Mage ability cooldowns are reduced by ${-{$s2=3000}/1000*{$d=4 seconds}/$t} sec over {$d=4 seconds}.}

Action Priority List

    aoe
    [n]:6.10
  • if_expr:buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
Touch of the Magi 0 (689) 0.0% (7.6%) 7.0 45.56sec 29393 23291

Stats Details: Touch Of The Magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 7.02 0.00 0.00 0.00 1.2620 0.0000 0.00 0.00 0.00% 23290.76 23290.76

Action Details: Touch Of The Magi

  • id:321507
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:4.0

Spelldata

  • id:321507
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]

Action Priority List

    aoe
    [j]:7.06
  • if_expr:buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
    Touch of the Magi (_explosion) 689 7.6% 7.0 45.43sec 29393 0 Direct 20.9 9851 0 9851 0.0%

Stats Details: Touch Of The Magi Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 7.02 20.94 0.00 0.00 0.0000 0.0000 206262.99 206262.99 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 20.94 15 27 9851.46 1480 46045 9960.95 6984 14072 206263 206263 0.00%

Action Details: Touch Of The Magi Explosion

  • id:210833
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:19369.82
  • base_dd_max:19369.82
  • base_dd_mult:1.00

Spelldata

  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc321507=Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]}
Simple Action Stats Execute Interval
NightFae_Dream_SB
Arcane Power 3.6 97.65sec

Stats Details: Arcane Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.56 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Power

  • id:12042
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].

Action Priority List

    aoe
    [k]:3.56
  • if_expr:((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
Berserking 2.0 194.97sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    shared_cds
    [v]:2.00
  • if_expr:buff.arcane_power.up
Conjure Mana Gem 1.0 0.00sec

Stats Details: Conjure Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Conjure Mana Gem

  • id:759
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:9000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:759
  • name:Conjure Mana Gem
  • school:arcane
  • tooltip:
  • description:Conjures a Mana Gem that can be used to instantly restore {$5405s1=10}% mana, and holds up to {$s2=3} charges. $@spellname118812 {$@spelldesc118812=Conjured items disappear if logged out for more than 15 minutes.}
Evocation 0.4 194.77sec

Stats Details: Evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.42 0.00 2.48 0.00 3.7335 0.6343 0.00 0.00 0.00% 0.00 0.00

Action Details: Evocation

  • id:12051
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Dream_SB
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.

Action Priority List

    aoe
    [q]:0.42
  • interrupt_if_expr:mana.pct>=85
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Dream_SB
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Dream_SB
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Deathly Fixation (potion) 1.5 300.63sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.49 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307497
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    shared_cds
    [t]:1.48
  • if_expr:buff.arcane_power.up
Rune of Power 6.9 43.83sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.91 0.00 0.00 0.00 1.1853 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    aoe
    [l]:6.94
  • if_expr:buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Time Warp 2.0 240.35sec

Stats Details: Time Warp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.98 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Time Warp

  • id:80353
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:2000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:80353
  • name:Time Warp
  • school:arcane
  • tooltip:Haste increased by $w1%. $?$W4>0[Time rate increased by $w4%.][]$?$W3=1[ When the effect ends, you die.][]
  • description:Warp the flow of time, increasing haste by {$s1=30}% $?a320919[and time rate by {$s4=0}% ][]for all party and raid members for {$d=40 seconds}. Allies will be unable to benefit from Bloodlust, Heroism, or Time Warp again for {$57724d=600 seconds}.$?a320920[ When the effect ends, you die.][]

Action Priority List

    shared_cds
    [u]:1.99
  • if_expr:runeforge.temporal_warp.equipped&buff.exhaustion.up
Replenish Mana (use_mana_gem) 2.8 120.95sec

Stats Details: Use Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.84 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Use Mana Gem

  • id:5405
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Dream_SB
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5405
  • name:Replenish Mana
  • school:physical
  • tooltip:Restoring $w2 mana every $t1 sec.
  • description:Restores {$s1=10}% mana.

Action Priority List

    shared_cds
    [r]:2.84
  • if_expr:(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Arcane Charge 59.5 160.0 5.1sec 1.4sec 3.7sec 73.79% 0.00% 2.6 (3.8) 0.0

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.8s / 15.9s
  • trigger_min/max:0.0s / 10.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 13.3s

Stack Uptimes

  • arcane_charge_1:18.82%
  • arcane_charge_2:16.30%
  • arcane_charge_3:17.15%
  • arcane_charge_4:21.53%

Spelldata

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 3.6 0.0 97.7sec 97.7sec 14.7sec 17.42% 0.00% 0.0 (0.0) 3.4

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:96.0s / 113.2s
  • trigger_min/max:96.0s / 113.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • arcane_power_1:17.42%

Spelldata

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Berserking 2.0 0.0 195.1sec 195.1sec 12.0sec 8.11% 6.52% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:192.2s / 201.2s
  • trigger_min/max:192.2s / 201.2s
  • trigger_pct:100.00%
  • duration_min/max:12.0s / 12.0s

Stack Uptimes

  • berserking_1:8.11%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.51% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.51%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Clearcasting 24.5 0.3 11.9sec 11.8sec 2.0sec 16.70% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_clearcasting
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • clearcasting_1:16.40%
  • clearcasting_2:0.31%
  • clearcasting_3:0.03%

Spelldata

  • id:263725
  • name:Clearcasting
  • tooltip:Your next Arcane Missiles or Arcane Explosion costs no mana{$?s321758=false}[ and Arcane Missiles fires an additional missile][].
  • description:{$@spelldesc79684=For each ${$c*100/{$s1=200}} mana you spend, you have a 1% chance to gain Clearcasting, making your next Arcane Missiles or Arcane Explosion free and channel {$277726s1=20}% faster.$?a321758[ Arcane Missiles fires {$321758s2=1} additional missile.][]}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Crimson Chorus 5.5 0.0 60.6sec 60.6sec 28.6sec 52.03% 0.00% 0.0 (0.0) 4.9

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_crimson_chorus
  • max_stacks:3
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:60.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:10.00
  • associated item:Cabalist's Hymnal

Stat Details

  • stat:crit_rating
  • amount:95.00

Trigger Details

  • interval_min/max:60.0s / 66.4s
  • trigger_min/max:60.0s / 66.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • crimson_chorus_1:17.94%
  • crimson_chorus_2:17.34%
  • crimson_chorus_3:16.76%

Spelldata

  • id:344803
  • name:Crimson Chorus
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc344806=Join the Crimson Chorus. Every minute, your Critical Strike swells by ${{$s1=44}*3} over ${{$344803d=10 seconds}*3} sec. before returning to normal. This effect is increased by {$s2=5}% for each member of the Crimson Chorus in your party.}
  • max_stacks:3
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Evocation 0.4 0.0 194.9sec 194.9sec 3.7sec 0.51% 0.00% 1.7 (1.7) 0.0

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_evocation
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:7.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:1.00

Trigger Details

  • interval_min/max:184.3s / 217.2s
  • trigger_min/max:184.3s / 217.2s
  • trigger_pct:100.00%
  • duration_min/max:0.4s / 4.3s

Stack Uptimes

  • evocation_1:0.51%

Spelldata

  • id:12051
  • name:Evocation
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Gladiator's Badge 3.6 0.0 97.7sec 97.7sec 14.7sec 17.42% 0.00% 0.0 (0.0) 3.4

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_gladiators_badge
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Sinful Aspirant's Badge of Ferocity

Stat Details

  • stat:intellect
  • amount:342.00

Trigger Details

  • interval_min/max:96.0s / 113.2s
  • trigger_min/max:96.0s / 113.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • gladiators_badge_1:17.42%

Spelldata

  • id:345228
  • name:Gladiator's Badge
  • tooltip:Primary stat increased by $w1.
  • description:Increases primary stat by {$s1=252} for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:0.00%
Potion of Deathly Fixation 1.5 0.0 300.6sec 300.6sec 23.1sec 11.26% 0.00% 0.0 (0.0) 1.3

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_potion_of_deathly_fixation
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:300.0s / 306.9s
  • trigger_min/max:300.0s / 306.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 25.0s

Stack Uptimes

  • potion_of_deathly_fixation_1:11.26%

Spelldata

  • id:307497
  • name:Potion of Deathly Fixation
  • tooltip:Chance to apply Deathly Fixation to your target.
  • description:Your damaging spells and abilities have a chance to apply Deathly Fixation to your target, dealing {$322253s1=43} Shadow damage over {$322253d=8 seconds} and stacking up to 5 times. Upon reaching 5 stacks, Deathly Fixation explodes, dealing {$322256s1=985} Shadow damage to the target. If you consume this potion while your weapon is augmented with Shadowcore Oil, the explosion damage is increased by {$s2=10}%. Lasts {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Rune of Power 10.5 0.0 29.7sec 29.7sec 11.8sec 41.06% 0.00% 0.0 (0.0) 10.1

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.0s / 55.1s
  • trigger_min/max:13.0s / 55.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • rune_of_power_1:41.06%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Social Butterfly 30.5 0.0 10.0sec 10.0sec 5.0sec 50.42% 0.00% 0.0 (0.0) 30.0

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_social_butterfly
  • max_stacks:1
  • base duration:5.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 10.0s
  • trigger_min/max:10.0s / 10.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 5.0s

Stack Uptimes

  • social_butterfly_1:50.42%

Spelldata

  • id:320130
  • name:Social Butterfly
  • tooltip:Versatility increased by $w1%.
  • description:{$@spelldesc319210=When at least {$s3=2} allies are within {$s4=8} yd, your Versatility increases by {$320130s1=3}% for {$320130d=5 seconds}. When this expires, {$s3=2} nearby allies gain ${{$320212s1=1}/{$320130s1=3}*100}% of this effect for {$320212d=5 seconds} before passing it back to you.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Temporal Warp 2.0 0.0 240.4sec 240.4sec 36.8sec 24.25% 0.00% 0.0 (0.0) 1.7

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_temporal_warp
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:240.0s / 241.0s
  • trigger_min/max:240.0s / 241.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 40.0s

Stack Uptimes

  • temporal_warp_1:24.25%

Spelldata

  • id:327355
  • name:Temporal Warp
  • tooltip:Haste increased by $w1%.
  • description:{$@spelldesc327351=While you have Temporal Displacement or other similar effects, you may use Time Warp to grant yourself {$327355s1=30}% Haste for {$327355d=40 seconds}.}
  • max_stacks:0
  • duration:40.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism)

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Benefit Avg % Min Max
Arcane Barrage Arcane Charge 4 100.00% 100.00% 100.00%
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 1.11% 0.35% 6.07% 0.8s 0.0s 6.0s
Conserve Phase 100.00% 100.00% 100.00% 299.9s 240.2s 360.0s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.0000.0000.000203.943144.203263.964
Evocation228.01869.344342.377279.101164.781358.980
Rune of Power8.4520.00337.73560.55321.372113.026
Touch of the Magi7.5190.00022.14054.24916.952110.507
Arcane Power1.5590.00017.2225.5801.51220.240
Arcane Barrage2.8300.00012.057167.281134.073201.446
Arcane Orb3.7190.00010.16753.38235.81870.685
Shifting Power7.0810.00037.30544.58029.78468.131
Time Warp0.8400.0001.3031.6681.2972.346

Burn Phases

Burn phase duration tracks the amount of time spent in each burn phase. This is defined as the time between a start_burn_phase and stop_burn_phase action being executed. Note that "execute" burn phases, i.e., the final burn of a fight, is also included.

Burn Phase Duration
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Mana at burn start is the mana level recorded (in percentage of total mana) when a start_burn_phase command is executed.

Mana at Burn Start
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
NightFae_Dream_SB
mana_regen Mana 684.86 398278.36 67.18% 581.54 5318.12 1.32%
Evocation Mana 17.85 21634.86 3.65% 1212.18 0.01 0.00%
Mana Gem Mana 2.84 19124.80 3.23% 6736.57 0.00 0.00%
Arcane Barrage Mana 58.68 153795.88 25.94% 2620.75 4335.42 2.74%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 66365.7 1975.82 2084.07 9699.4 34895.3 55.4 67365.7
Usage Type Count Total Avg RPE APR
NightFae_Dream_SB
arcane_explosion Mana 155.7 581215.4 3734.1 3734.7 2.0
arcane_orb Mana 14.2 6301.3 443.6 443.5 34.9
shifting_power Mana 6.1 15247.2 2500.0 2499.5 5.5
time_warp Mana 2.0 3970.0 2000.0 2000.2 0.0
touch_of_the_magi Mana 7.0 17520.6 2496.8 2496.7 11.8

Statistics & Data Analysis

Fight Length
NightFae_Dream_SB Fight Length
Count 1319
Mean 299.94
Minimum 240.20
Maximum 359.96
Spread ( max - min ) 119.76
Range [ ( max - min ) / 2 * 100% ] 19.96%
DPS
NightFae_Dream_SB Damage Per Second
Count 1319
Mean 9109.13
Minimum 8565.48
Maximum 9673.63
Spread ( max - min ) 1108.15
Range [ ( max - min ) / 2 * 100% ] 6.08%
Standard Deviation 191.3497
5th Percentile 8807.11
95th Percentile 9441.11
( 95th Percentile - 5th Percentile ) 634.00
Mean Distribution
Standard Deviation 5.2687
95.00% Confidence Interval ( 9098.81 - 9119.46 )
Normalized 95.00% Confidence Interval ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 17
0.1% Error 1696
0.1 Scale Factor Error with Delta=300 313
0.05 Scale Factor Error with Delta=300 1251
0.01 Scale Factor Error with Delta=300 31257
Priority Target DPS
NightFae_Dream_SB Priority Target Damage Per Second
Count 1319
Mean 3838.42
Minimum 3455.93
Maximum 4256.46
Spread ( max - min ) 800.54
Range [ ( max - min ) / 2 * 100% ] 10.43%
Standard Deviation 120.5697
5th Percentile 3651.12
95th Percentile 4039.55
( 95th Percentile - 5th Percentile ) 388.43
Mean Distribution
Standard Deviation 3.3198
95.00% Confidence Interval ( 3831.92 - 3844.93 )
Normalized 95.00% Confidence Interval ( 99.83% - 100.17% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 38
0.1% Error 3791
0.1 Scale Factor Error with Delta=300 125
0.05 Scale Factor Error with Delta=300 497
0.01 Scale Factor Error with Delta=300 12410
DPS(e)
NightFae_Dream_SB Damage Per Second (Effective)
Count 1319
Mean 9109.13
Minimum 8565.48
Maximum 9673.63
Spread ( max - min ) 1108.15
Range [ ( max - min ) / 2 * 100% ] 6.08%
Damage
NightFae_Dream_SB Damage
Count 1319
Mean 2723562.04
Minimum 2173239.56
Maximum 3313359.49
Spread ( max - min ) 1140119.93
Range [ ( max - min ) / 2 * 100% ] 20.93%
DTPS
NightFae_Dream_SB Damage Taken Per Second
Count 1319
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
NightFae_Dream_SB Healing Per Second
Count 1319
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
NightFae_Dream_SB Healing Per Second (Effective)
Count 1319
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
NightFae_Dream_SB Heal
Count 1319
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
NightFae_Dream_SB Healing Taken Per Second
Count 1319
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
NightFae_Dream_SB Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
NightFae_Dream_SBTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
NightFae_Dream_SB Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 variable,name=prepull_evo,op=reset,default=0
1 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
2 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
3 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
4 0.00 variable,name=have_opened,op=reset,default=0
5 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
6 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
7 0.00 variable,name=final_burn,op=set,value=0
8 0.00 variable,name=rs_max_delay,op=reset,default=5
9 0.00 variable,name=ap_max_delay,op=reset,default=10
A 0.00 variable,name=rop_max_delay,op=reset,default=20
B 0.00 variable,name=totm_max_delay,op=reset,default=5
C 0.00 variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
D 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
E 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
F 0.00 variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
G 0.00 variable,name=barrage_mana_pct,op=reset,default=70
H 0.00 variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
I 0.00 variable,name=ap_minimum_mana_pct,op=reset,default=30
J 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
K 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
L 0.00 variable,name=totm_max_charges,op=reset,default=2
M 0.00 variable,name=aoe_totm_max_charges,op=reset,default=2
N 0.00 variable,name=am_spam,op=reset,default=0
O 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
P 0.00 variable,name=am_spam_evo_pct,op=reset,default=15
Q 0.00 flask
R 0.00 food
S 0.00 augmentation
T 0.00 arcane_familiar
U 0.00 arcane_intellect
V 0.00 conjure_mana_gem
W 0.00 snapshot_stats
X 0.00 mirror_image
Y 0.00 frostbolt,if=variable.prepull_evo<=0
Z 0.00 evocation,if=variable.prepull_evo>0
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
a 0.00 call_action_list,name=shared_cds
b 0.00 call_action_list,name=essences
c 0.00 call_action_list,name=aoe,if=active_enemies>2
d 0.00 call_action_list,name=opener,if=variable.have_opened<=0
e 0.00 call_action_list,name=am_spam,if=variable.am_spam=1
f 0.00 call_action_list,name=cooldowns
g 0.00 call_action_list,name=rotation,if=variable.final_burn=0
h 0.00 call_action_list,name=final_burn,if=variable.final_burn=1
i 0.00 call_action_list,name=movement
actions.aoe
# count action,conditions
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
0.00 arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
0.00 mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
j 7.06 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
k 3.56 arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
l 6.94 rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
0.00 presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
0.00 arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
0.00 supernova
m 14.21 arcane_orb,if=buff.arcane_charge.stack=0
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
n 6.10 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
o 155.65 arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
0.00 arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
p 58.68 arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
q 0.42 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.shared_cds
# count action,conditions
r 2.84 use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
s 3.56 use_items,if=buff.arcane_power.up
t 1.48 potion,if=buff.arcane_power.up
u 1.99 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
0.00 lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
v 2.00 berserking,if=buff.arcane_power.up
0.00 blood_fury,if=buff.arcane_power.up
0.00 fireblood,if=buff.arcane_power.up
0.00 ancestral_call,if=buff.arcane_power.up

Sample Sequence

045789ABDGHILMNPQRVXYjukstvpmpoooopoooopoooolpoooopooroopmpooonopoooopmpoooopoooopojlpoooopmpoooopoooopnmpoojlpoooopooookspmpoooopoooopooonopjlpmpoooopoooropoooopmpoooopooonopjlpmpoooopoooopooooksvpmpoooopoooopnjlpmpoooopoooopoooopmpuoooopoooopooonopjrlpmpoooopoooopoooopoooopmpooookspooooptoooopjlpmpoooopoonoopmpoooopoojlpooo

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 prepull_evo Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat 4 have_opened Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat 5 have_opened Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat 7 final_burn Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat 8 rs_max_delay Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat 9 ap_max_delay Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat A rop_max_delay Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat B totm_max_delay Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat D totm_max_delay Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat G barrage_mana_pct Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat H barrage_mana_pct Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat I ap_minimum_mana_pct Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat L totm_max_charges Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat M aoe_totm_max_charges Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat N am_spam Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat P am_spam_evo_pct Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat Q flask NightFae_Dream_SB 67365.7/67366: 100% mana
Pre precombat R food NightFae_Dream_SB 67365.7/67366: 100% mana
Pre precombat V conjure_mana_gem Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat X mirror_image Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat Y frostbolt Fluffy_Pillow 67365.7/67366: 100% mana
0:00.000 aoe j touch_of_the_magi Fluffy_Pillow 66365.7/67366: 99% mana social_butterfly
0:01.298 shared_cds u time_warp Fluffy_Pillow 64869.8/67366: 96% mana bloodlust, arcane_charge(4), crimson_chorus, social_butterfly
0:01.298 aoe k arcane_power Fluffy_Pillow 62869.8/67366: 93% mana bloodlust, arcane_charge(4), temporal_warp, crimson_chorus, social_butterfly
0:01.298 shared_cds s use_items Fluffy_Pillow 62869.8/67366: 93% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, crimson_chorus, social_butterfly
0:01.298 shared_cds t potion Fluffy_Pillow 62869.8/67366: 93% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, crimson_chorus, social_butterfly, gladiators_badge
0:01.298 shared_cds v berserking Fluffy_Pillow 62869.8/67366: 93% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, crimson_chorus, social_butterfly, potion_of_deathly_fixation, gladiators_badge
0:01.298 aoe p arcane_barrage Fluffy_Pillow 62869.8/67366: 93% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, crimson_chorus, social_butterfly, potion_of_deathly_fixation, gladiators_badge
0:02.053 aoe m arcane_orb Fluffy_Pillow 66581.6/67366: 99% mana bloodlust, berserking, arcane_power, rune_of_power, temporal_warp, crimson_chorus, social_butterfly, potion_of_deathly_fixation, gladiators_badge
0:02.807 aoe p arcane_barrage Fluffy_Pillow 67347.5/67366: 100% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, crimson_chorus, social_butterfly, potion_of_deathly_fixation, gladiators_badge
0:03.560 aoe o arcane_explosion Fluffy_Pillow 67365.7/67366: 100% mana bloodlust, berserking, arcane_power, rune_of_power, temporal_warp, crimson_chorus, social_butterfly, potion_of_deathly_fixation, gladiators_badge
0:04.315 aoe o arcane_explosion Fluffy_Pillow 65882.9/67366: 98% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, temporal_warp, crimson_chorus, social_butterfly, potion_of_deathly_fixation, gladiators_badge
0:05.070 aoe o arcane_explosion Fluffy_Pillow 64400.2/67366: 96% mana bloodlust, berserking, arcane_charge(2), arcane_power, clearcasting, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:05.825 aoe o arcane_explosion Fluffy_Pillow 65417.4/67366: 97% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:06.579 aoe p arcane_barrage Fluffy_Pillow 63933.3/67366: 95% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:07.332 aoe o arcane_explosion Fluffy_Pillow 67365.7/67366: 100% mana bloodlust, berserking, arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:08.086 aoe o arcane_explosion Fluffy_Pillow 65881.6/67366: 98% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:08.841 aoe o arcane_explosion Fluffy_Pillow 64398.8/67366: 96% mana bloodlust, berserking, arcane_charge(2), arcane_power, clearcasting, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:09.596 aoe o arcane_explosion Fluffy_Pillow 65416.0/67366: 97% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:10.350 aoe p arcane_barrage Fluffy_Pillow 63931.9/67366: 95% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, crimson_chorus(2), social_butterfly, potion_of_deathly_fixation, gladiators_badge
0:11.106 aoe o arcane_explosion Fluffy_Pillow 67365.7/67366: 100% mana bloodlust, berserking, arcane_power, rune_of_power, temporal_warp, crimson_chorus(2), social_butterfly, potion_of_deathly_fixation, gladiators_badge
0:11.861 aoe o arcane_explosion Fluffy_Pillow 65882.9/67366: 98% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, temporal_warp, crimson_chorus(2), social_butterfly, potion_of_deathly_fixation, gladiators_badge
0:12.616 aoe o arcane_explosion Fluffy_Pillow 64400.2/67366: 96% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, temporal_warp, crimson_chorus(2), social_butterfly, potion_of_deathly_fixation, gladiators_badge
0:13.369 aoe o arcane_explosion Fluffy_Pillow 62914.7/67366: 93% mana bloodlust, arcane_charge(3), arcane_power, clearcasting, temporal_warp, crimson_chorus(2), social_butterfly, potion_of_deathly_fixation, gladiators_badge
0:14.139 aoe l rune_of_power Fluffy_Pillow 63952.1/67366: 95% mana bloodlust, arcane_charge(4), arcane_power, temporal_warp, crimson_chorus(2), social_butterfly, potion_of_deathly_fixation, gladiators_badge
0:14.910 aoe p arcane_barrage Fluffy_Pillow 64990.9/67366: 96% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, crimson_chorus(2), social_butterfly, potion_of_deathly_fixation, gladiators_badge
0:15.681 aoe o arcane_explosion Fluffy_Pillow 67365.7/67366: 100% mana bloodlust, arcane_power, rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:16.451 aoe o arcane_explosion Fluffy_Pillow 65903.1/67366: 98% mana bloodlust, arcane_charge, rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation
0:17.222 aoe o arcane_explosion Fluffy_Pillow 61941.9/67366: 92% mana bloodlust, arcane_charge(2), clearcasting, rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation
0:17.994 aoe o arcane_explosion Fluffy_Pillow 62982.1/67366: 93% mana bloodlust, arcane_charge(3), rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation
0:18.765 aoe p arcane_barrage Fluffy_Pillow 59020.8/67366: 88% mana bloodlust, arcane_charge(4), rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation
0:19.536 aoe o arcane_explosion Fluffy_Pillow 62754.2/67366: 93% mana bloodlust, rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation
0:20.307 aoe o arcane_explosion Fluffy_Pillow 58793.0/67366: 87% mana bloodlust, arcane_charge, rune_of_power, temporal_warp, crimson_chorus(3), social_butterfly, potion_of_deathly_fixation
0:21.078 shared_cds r use_mana_gem NightFae_Dream_SB 54831.8/67366: 81% mana bloodlust, arcane_charge(2), clearcasting, rune_of_power, temporal_warp, crimson_chorus(3), social_butterfly, potion_of_deathly_fixation
0:21.078 aoe o arcane_explosion Fluffy_Pillow 61568.4/67366: 91% mana bloodlust, arcane_charge(2), clearcasting, rune_of_power, temporal_warp, crimson_chorus(3), social_butterfly, potion_of_deathly_fixation
0:21.849 aoe o arcane_explosion Fluffy_Pillow 62607.1/67366: 93% mana bloodlust, arcane_charge(3), rune_of_power, temporal_warp, crimson_chorus(3), social_butterfly, potion_of_deathly_fixation
0:22.619 aoe p arcane_barrage Fluffy_Pillow 58644.6/67366: 87% mana bloodlust, arcane_charge(4), rune_of_power, temporal_warp, crimson_chorus(3), social_butterfly, potion_of_deathly_fixation
0:23.390 aoe m arcane_orb Fluffy_Pillow 62378.0/67366: 93% mana bloodlust, rune_of_power, temporal_warp, crimson_chorus(3), social_butterfly, potion_of_deathly_fixation
0:24.161 aoe p arcane_barrage Fluffy_Pillow 62916.8/67366: 93% mana bloodlust, arcane_charge(4), rune_of_power, temporal_warp, crimson_chorus(3), social_butterfly, potion_of_deathly_fixation
0:24.932 aoe o arcane_explosion Fluffy_Pillow 66650.2/67366: 99% mana bloodlust, rune_of_power, temporal_warp, crimson_chorus(3), social_butterfly, potion_of_deathly_fixation
0:25.703 aoe o arcane_explosion Fluffy_Pillow 62689.0/67366: 93% mana bloodlust, arcane_charge, rune_of_power, temporal_warp, crimson_chorus(3), potion_of_deathly_fixation
0:26.473 aoe o arcane_explosion Fluffy_Pillow 58726.4/67366: 87% mana bloodlust, arcane_charge(2), rune_of_power, temporal_warp, crimson_chorus(3)
0:27.243 aoe n shifting_power Fluffy_Pillow 54763.8/67366: 81% mana bloodlust, arcane_charge(3), temporal_warp, crimson_chorus(3)
0:29.430 aoe o arcane_explosion Fluffy_Pillow 55210.4/67366: 82% mana bloodlust, arcane_charge(3), temporal_warp, crimson_chorus(3)
0:30.199 aoe p arcane_barrage Fluffy_Pillow 51246.5/67366: 76% mana bloodlust, arcane_charge(4), clearcasting, temporal_warp, crimson_chorus(3), social_butterfly
0:30.969 aoe o arcane_explosion Fluffy_Pillow 54978.5/67366: 82% mana bloodlust, clearcasting, temporal_warp, social_butterfly
0:31.740 aoe o arcane_explosion Fluffy_Pillow 56017.3/67366: 83% mana bloodlust, arcane_charge, temporal_warp, social_butterfly
0:32.512 aoe o arcane_explosion Fluffy_Pillow 52057.4/67366: 77% mana bloodlust, arcane_charge(2), temporal_warp, social_butterfly
0:33.282 aoe o arcane_explosion Fluffy_Pillow 48094.9/67366: 71% mana bloodlust, arcane_charge(3), temporal_warp, social_butterfly
0:34.052 aoe p arcane_barrage Fluffy_Pillow 44132.3/67366: 66% mana bloodlust, arcane_charge(4), temporal_warp, social_butterfly
0:34.823 aoe m arcane_orb Fluffy_Pillow 47865.7/67366: 71% mana bloodlust, temporal_warp, social_butterfly
0:35.593 aoe p arcane_barrage Fluffy_Pillow 48403.2/67366: 72% mana bloodlust, arcane_charge(4), temporal_warp
0:36.363 aoe o arcane_explosion Fluffy_Pillow 52135.2/67366: 77% mana bloodlust, temporal_warp
0:37.133 aoe o arcane_explosion Fluffy_Pillow 48172.6/67366: 72% mana bloodlust, arcane_charge, clearcasting, temporal_warp
0:37.904 aoe o arcane_explosion Fluffy_Pillow 49211.4/67366: 73% mana bloodlust, arcane_charge(2), temporal_warp
0:38.674 aoe o arcane_explosion Fluffy_Pillow 45248.9/67366: 67% mana bloodlust, arcane_charge(3), temporal_warp
0:39.444 aoe p arcane_barrage Fluffy_Pillow 41286.3/67366: 61% mana bloodlust, arcane_charge(4), temporal_warp
0:40.214 aoe o arcane_explosion Fluffy_Pillow 45018.3/67366: 67% mana bloodlust, temporal_warp, social_butterfly
0:40.986 aoe o arcane_explosion Fluffy_Pillow 41058.5/67366: 61% mana bloodlust, arcane_charge, temporal_warp, social_butterfly
0:41.756 aoe o arcane_explosion Fluffy_Pillow 37095.9/67366: 55% mana arcane_charge(2), social_butterfly
0:43.055 aoe o arcane_explosion Fluffy_Pillow 33846.1/67366: 50% mana arcane_charge(3), social_butterfly
0:44.355 aoe p arcane_barrage Fluffy_Pillow 30597.6/67366: 45% mana arcane_charge(4), social_butterfly
0:45.654 aoe o arcane_explosion Fluffy_Pillow 35042.4/67366: 52% mana
0:46.953 aoe j touch_of_the_magi Fluffy_Pillow 31792.5/67366: 47% mana arcane_charge
0:48.255 aoe l rune_of_power Fluffy_Pillow 31046.7/67366: 46% mana arcane_charge(4)
0:49.555 aoe p arcane_barrage Fluffy_Pillow 32798.2/67366: 49% mana arcane_charge(4), rune_of_power
0:50.854 aoe o arcane_explosion Fluffy_Pillow 37243.0/67366: 55% mana rune_of_power, social_butterfly
0:52.155 aoe o arcane_explosion Fluffy_Pillow 33995.9/67366: 50% mana arcane_charge, rune_of_power, social_butterfly
0:53.455 aoe o arcane_explosion Fluffy_Pillow 30747.4/67366: 46% mana arcane_charge(2), clearcasting, rune_of_power, social_butterfly
0:54.755 aoe o arcane_explosion Fluffy_Pillow 32498.9/67366: 48% mana arcane_charge(3), rune_of_power, social_butterfly
0:56.055 aoe p arcane_barrage Fluffy_Pillow 29250.4/67366: 43% mana arcane_charge(4), rune_of_power
0:57.356 aoe m arcane_orb Fluffy_Pillow 33697.9/67366: 50% mana rune_of_power
0:58.655 aoe p arcane_barrage Fluffy_Pillow 34948.1/67366: 52% mana arcane_charge(4), rune_of_power
0:59.954 aoe o arcane_explosion Fluffy_Pillow 39392.8/67366: 58% mana rune_of_power
1:01.253 aoe o arcane_explosion Fluffy_Pillow 36143.0/67366: 54% mana arcane_charge, rune_of_power, social_butterfly
1:02.552 aoe o arcane_explosion Fluffy_Pillow 32893.2/67366: 49% mana arcane_charge(2), clearcasting, crimson_chorus, social_butterfly
1:03.853 aoe o arcane_explosion Fluffy_Pillow 34646.0/67366: 51% mana arcane_charge(3), crimson_chorus, social_butterfly
1:05.152 aoe p arcane_barrage Fluffy_Pillow 31396.2/67366: 47% mana arcane_charge(4), clearcasting, crimson_chorus
1:06.452 aoe o arcane_explosion Fluffy_Pillow 35842.3/67366: 53% mana clearcasting, crimson_chorus
1:07.752 aoe o arcane_explosion Fluffy_Pillow 37593.8/67366: 56% mana arcane_charge, crimson_chorus
1:09.052 aoe o arcane_explosion Fluffy_Pillow 34345.3/67366: 51% mana arcane_charge(2), crimson_chorus
1:10.353 aoe o arcane_explosion Fluffy_Pillow 31098.2/67366: 46% mana arcane_charge(3), crimson_chorus, social_butterfly
1:11.651 aoe p arcane_barrage Fluffy_Pillow 27847.0/67366: 41% mana arcane_charge(4), crimson_chorus(2), social_butterfly
1:12.951 aoe n shifting_power Fluffy_Pillow 32293.1/67366: 48% mana crimson_chorus(2), social_butterfly
1:16.589 aoe m arcane_orb Fluffy_Pillow 34694.7/67366: 52% mana crimson_chorus(2)
1:17.888 aoe p arcane_barrage Fluffy_Pillow 35944.8/67366: 53% mana arcane_charge(4), crimson_chorus(2)
1:19.188 aoe o arcane_explosion Fluffy_Pillow 40391.0/67366: 60% mana crimson_chorus(2)
1:20.489 aoe o arcane_explosion Fluffy_Pillow 37143.8/67366: 55% mana arcane_charge, crimson_chorus(2), social_butterfly
1:21.789 aoe j touch_of_the_magi Fluffy_Pillow 33895.3/67366: 50% mana arcane_charge(2), crimson_chorus(3), social_butterfly
1:23.089 aoe l rune_of_power Fluffy_Pillow 33146.8/67366: 49% mana arcane_charge(4), clearcasting, crimson_chorus(3), social_butterfly
1:24.389 aoe p arcane_barrage Fluffy_Pillow 34898.4/67366: 52% mana arcane_charge(4), clearcasting, rune_of_power, crimson_chorus(3), social_butterfly
1:25.688 aoe o arcane_explosion Fluffy_Pillow 39343.1/67366: 58% mana clearcasting, rune_of_power, crimson_chorus(3)
1:26.988 aoe o arcane_explosion Fluffy_Pillow 41094.7/67366: 61% mana arcane_charge, rune_of_power, crimson_chorus(3)
1:28.288 aoe o arcane_explosion Fluffy_Pillow 37846.2/67366: 56% mana arcane_charge(2), rune_of_power, crimson_chorus(3)
1:29.588 aoe o arcane_explosion Fluffy_Pillow 34597.7/67366: 51% mana arcane_charge(3), rune_of_power, crimson_chorus(3)
1:30.888 aoe p arcane_barrage Fluffy_Pillow 31349.2/67366: 47% mana arcane_charge(4), rune_of_power, crimson_chorus(3), social_butterfly
1:32.187 aoe o arcane_explosion Fluffy_Pillow 35794.0/67366: 53% mana rune_of_power, social_butterfly
1:33.487 aoe o arcane_explosion Fluffy_Pillow 32545.5/67366: 48% mana arcane_charge, rune_of_power, social_butterfly
1:34.785 aoe o arcane_explosion Fluffy_Pillow 29294.3/67366: 43% mana arcane_charge(2), rune_of_power, social_butterfly
1:36.085 aoe o arcane_explosion Fluffy_Pillow 26045.8/67366: 39% mana arcane_charge(3), rune_of_power
1:37.386 aoe k arcane_power Fluffy_Pillow 22798.7/67366: 34% mana arcane_charge(4)
1:37.386 shared_cds s use_items Fluffy_Pillow 22798.7/67366: 34% mana arcane_charge(4), arcane_power, rune_of_power
1:37.386 aoe p arcane_barrage Fluffy_Pillow 22798.7/67366: 34% mana arcane_charge(4), arcane_power, rune_of_power, gladiators_badge
1:38.685 aoe m arcane_orb Fluffy_Pillow 27243.4/67366: 40% mana arcane_power, rune_of_power, gladiators_badge
1:39.984 aoe p arcane_barrage Fluffy_Pillow 28743.6/67366: 43% mana arcane_charge(4), arcane_power, rune_of_power, gladiators_badge
1:41.283 aoe o arcane_explosion Fluffy_Pillow 33188.4/67366: 49% mana arcane_power, rune_of_power, social_butterfly, gladiators_badge
1:42.584 aoe o arcane_explosion Fluffy_Pillow 32441.3/67366: 48% mana arcane_charge, arcane_power, rune_of_power, social_butterfly, gladiators_badge
1:43.883 aoe o arcane_explosion Fluffy_Pillow 31691.4/67366: 47% mana arcane_charge(2), arcane_power, rune_of_power, social_butterfly, gladiators_badge
1:45.181 aoe o arcane_explosion Fluffy_Pillow 30940.2/67366: 46% mana arcane_charge(3), arcane_power, rune_of_power, gladiators_badge
1:46.480 aoe p arcane_barrage Fluffy_Pillow 30190.4/67366: 45% mana arcane_charge(4), arcane_power, rune_of_power, gladiators_badge
1:47.780 aoe o arcane_explosion Fluffy_Pillow 34636.5/67366: 51% mana arcane_power, rune_of_power, gladiators_badge
1:49.080 aoe o arcane_explosion Fluffy_Pillow 33888.0/67366: 50% mana arcane_charge, arcane_power, rune_of_power, gladiators_badge
1:50.379 aoe o arcane_explosion Fluffy_Pillow 33138.2/67366: 49% mana arcane_charge(2), arcane_power, social_butterfly, gladiators_badge
1:51.679 aoe o arcane_explosion Fluffy_Pillow 32389.7/67366: 48% mana arcane_charge(3), arcane_power, social_butterfly, gladiators_badge
1:52.979 aoe p arcane_barrage Fluffy_Pillow 31641.2/67366: 47% mana arcane_charge(4), clearcasting, social_butterfly
1:54.278 aoe o arcane_explosion Fluffy_Pillow 36086.0/67366: 54% mana clearcasting, social_butterfly
1:55.577 aoe o arcane_explosion Fluffy_Pillow 37836.2/67366: 56% mana arcane_charge
1:56.876 aoe o arcane_explosion Fluffy_Pillow 34586.3/67366: 51% mana arcane_charge(2)
1:58.176 aoe n shifting_power Fluffy_Pillow 31337.8/67366: 47% mana arcane_charge(3)
2:01.860 aoe o arcane_explosion Fluffy_Pillow 33801.3/67366: 50% mana arcane_charge(3), clearcasting, crimson_chorus, social_butterfly
2:03.158 aoe p arcane_barrage Fluffy_Pillow 35550.2/67366: 53% mana arcane_charge(4), crimson_chorus, social_butterfly
2:04.457 aoe j touch_of_the_magi Fluffy_Pillow 39994.9/67366: 59% mana crimson_chorus, social_butterfly
2:05.758 aoe l rune_of_power Fluffy_Pillow 39247.8/67366: 58% mana arcane_charge(4), crimson_chorus
2:07.057 aoe p arcane_barrage Fluffy_Pillow 40998.0/67366: 61% mana arcane_charge(4), rune_of_power, crimson_chorus
2:08.356 aoe m arcane_orb Fluffy_Pillow 45442.8/67366: 67% mana rune_of_power, crimson_chorus
2:09.656 aoe p arcane_barrage Fluffy_Pillow 46694.3/67366: 69% mana arcane_charge(4), rune_of_power, crimson_chorus
2:10.957 aoe o arcane_explosion Fluffy_Pillow 51141.7/67366: 76% mana rune_of_power, crimson_chorus, social_butterfly
2:12.256 aoe o arcane_explosion Fluffy_Pillow 47891.9/67366: 71% mana arcane_charge, rune_of_power, crimson_chorus(2), social_butterfly
2:13.556 aoe o arcane_explosion Fluffy_Pillow 44643.4/67366: 66% mana arcane_charge(2), rune_of_power, crimson_chorus(2), social_butterfly
2:14.855 aoe o arcane_explosion Fluffy_Pillow 41393.6/67366: 61% mana arcane_charge(3), rune_of_power, crimson_chorus(2), social_butterfly
2:16.156 aoe p arcane_barrage Fluffy_Pillow 38146.4/67366: 57% mana arcane_charge(4), rune_of_power, crimson_chorus(2)
2:17.455 aoe o arcane_explosion Fluffy_Pillow 42591.2/67366: 63% mana rune_of_power, crimson_chorus(2)
2:18.754 aoe o arcane_explosion Fluffy_Pillow 39341.4/67366: 58% mana arcane_charge, rune_of_power, crimson_chorus(2)
2:20.053 aoe o arcane_explosion Fluffy_Pillow 36091.5/67366: 54% mana arcane_charge(2), crimson_chorus(2), social_butterfly
2:21.352 shared_cds r use_mana_gem NightFae_Dream_SB 32841.7/67366: 49% mana arcane_charge(3), crimson_chorus(2), social_butterfly
2:21.352 aoe o arcane_explosion Fluffy_Pillow 39578.3/67366: 59% mana arcane_charge(3), crimson_chorus(2), social_butterfly
2:22.652 aoe p arcane_barrage Fluffy_Pillow 36329.8/67366: 54% mana arcane_charge(4), crimson_chorus(3), social_butterfly
2:23.952 aoe o arcane_explosion Fluffy_Pillow 40775.9/67366: 61% mana crimson_chorus(3), social_butterfly
2:25.252 aoe o arcane_explosion Fluffy_Pillow 37527.4/67366: 56% mana arcane_charge, crimson_chorus(3)
2:26.553 aoe o arcane_explosion Fluffy_Pillow 34280.3/67366: 51% mana arcane_charge(2), crimson_chorus(3)
2:27.854 aoe o arcane_explosion Fluffy_Pillow 31033.1/67366: 46% mana arcane_charge(3), crimson_chorus(3)
2:29.154 aoe p arcane_barrage Fluffy_Pillow 27784.7/67366: 41% mana arcane_charge(4), clearcasting, crimson_chorus(3)
2:30.451 aoe m arcane_orb Fluffy_Pillow 32226.7/67366: 48% mana clearcasting, crimson_chorus(3), social_butterfly
2:31.750 aoe p arcane_barrage Fluffy_Pillow 33476.9/67366: 50% mana arcane_charge(4), clearcasting, social_butterfly
2:33.049 aoe o arcane_explosion Fluffy_Pillow 37921.7/67366: 56% mana clearcasting, social_butterfly
2:34.350 aoe o arcane_explosion Fluffy_Pillow 39674.6/67366: 59% mana arcane_charge, social_butterfly
2:35.651 aoe o arcane_explosion Fluffy_Pillow 36427.4/67366: 54% mana arcane_charge(2)
2:36.950 aoe o arcane_explosion Fluffy_Pillow 33177.6/67366: 49% mana arcane_charge(3)
2:38.249 aoe p arcane_barrage Fluffy_Pillow 29927.7/67366: 44% mana arcane_charge(4)
2:39.548 aoe o arcane_explosion Fluffy_Pillow 34372.5/67366: 51% mana
2:40.847 aoe o arcane_explosion Fluffy_Pillow 31122.7/67366: 46% mana arcane_charge, social_butterfly
2:42.147 aoe o arcane_explosion Fluffy_Pillow 27874.2/67366: 41% mana arcane_charge(2), social_butterfly
2:43.446 aoe n shifting_power Fluffy_Pillow 24624.4/67366: 37% mana arcane_charge(3), social_butterfly
2:47.096 aoe o arcane_explosion Fluffy_Pillow 27042.0/67366: 40% mana arcane_charge(3)
2:48.393 aoe p arcane_barrage Fluffy_Pillow 23789.5/67366: 35% mana arcane_charge(4)
2:49.691 aoe j touch_of_the_magi Fluffy_Pillow 28233.0/67366: 42% mana
2:50.993 aoe l rune_of_power Fluffy_Pillow 27487.2/67366: 41% mana arcane_charge(4), clearcasting, social_butterfly
2:52.291 aoe p arcane_barrage Fluffy_Pillow 29236.0/67366: 43% mana arcane_charge(4), clearcasting, rune_of_power, social_butterfly
2:53.593 aoe m arcane_orb Fluffy_Pillow 33684.8/67366: 50% mana clearcasting, rune_of_power, social_butterfly
2:54.892 aoe p arcane_barrage Fluffy_Pillow 34935.0/67366: 52% mana arcane_charge(4), clearcasting, rune_of_power, social_butterfly
2:56.192 aoe o arcane_explosion Fluffy_Pillow 39381.1/67366: 58% mana clearcasting, rune_of_power
2:57.492 aoe o arcane_explosion Fluffy_Pillow 41132.6/67366: 61% mana arcane_charge, rune_of_power
2:58.791 aoe o arcane_explosion Fluffy_Pillow 37882.8/67366: 56% mana arcane_charge(2), clearcasting, rune_of_power
3:00.090 aoe o arcane_explosion Fluffy_Pillow 39632.9/67366: 59% mana arcane_charge(3), rune_of_power, social_butterfly
3:01.392 aoe p arcane_barrage Fluffy_Pillow 36387.1/67366: 54% mana arcane_charge(4), rune_of_power, social_butterfly
3:02.692 aoe o arcane_explosion Fluffy_Pillow 40833.3/67366: 61% mana rune_of_power, crimson_chorus, social_butterfly
3:03.991 aoe o arcane_explosion Fluffy_Pillow 37583.4/67366: 56% mana arcane_charge, rune_of_power, crimson_chorus, social_butterfly
3:05.291 aoe o arcane_explosion Fluffy_Pillow 34334.9/67366: 51% mana arcane_charge(2), clearcasting, crimson_chorus
3:06.589 aoe o arcane_explosion Fluffy_Pillow 36083.8/67366: 54% mana arcane_charge(3), crimson_chorus
3:07.887 aoe p arcane_barrage Fluffy_Pillow 32832.6/67366: 49% mana arcane_charge(4), crimson_chorus
3:09.188 aoe o arcane_explosion Fluffy_Pillow 37280.1/67366: 55% mana crimson_chorus
3:10.488 aoe o arcane_explosion Fluffy_Pillow 34031.6/67366: 51% mana arcane_charge, crimson_chorus, social_butterfly
3:11.789 aoe o arcane_explosion Fluffy_Pillow 30784.4/67366: 46% mana arcane_charge(2), crimson_chorus, social_butterfly
3:13.088 aoe o arcane_explosion Fluffy_Pillow 27534.6/67366: 41% mana arcane_charge(3), clearcasting, crimson_chorus(2), social_butterfly
3:14.387 aoe k arcane_power Fluffy_Pillow 29284.7/67366: 43% mana arcane_charge(4), crimson_chorus(2), social_butterfly
3:14.387 shared_cds s use_items Fluffy_Pillow 29284.7/67366: 43% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), social_butterfly
3:14.387 shared_cds v berserking Fluffy_Pillow 29284.7/67366: 43% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), social_butterfly, gladiators_badge
3:14.387 aoe p arcane_barrage Fluffy_Pillow 29284.7/67366: 43% mana berserking, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), social_butterfly, gladiators_badge
3:15.570 aoe m arcane_orb Fluffy_Pillow 33573.2/67366: 50% mana berserking, arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
3:16.753 aoe p arcane_barrage Fluffy_Pillow 34917.1/67366: 52% mana berserking, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
3:17.936 aoe o arcane_explosion Fluffy_Pillow 39205.6/67366: 58% mana berserking, arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
3:19.118 aoe o arcane_explosion Fluffy_Pillow 38298.1/67366: 57% mana berserking, arcane_charge, arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
3:20.300 aoe o arcane_explosion Fluffy_Pillow 37390.7/67366: 56% mana berserking, arcane_charge(2), arcane_power, rune_of_power, crimson_chorus(2), social_butterfly, gladiators_badge
3:21.484 aoe o arcane_explosion Fluffy_Pillow 36485.9/67366: 54% mana berserking, arcane_charge(3), arcane_power, rune_of_power, crimson_chorus(2), social_butterfly, gladiators_badge
3:22.665 aoe p arcane_barrage Fluffy_Pillow 35577.1/67366: 53% mana berserking, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(3), social_butterfly, gladiators_badge
3:23.847 aoe o arcane_explosion Fluffy_Pillow 39864.2/67366: 59% mana berserking, arcane_power, rune_of_power, crimson_chorus(3), social_butterfly, gladiators_badge
3:25.031 aoe o arcane_explosion Fluffy_Pillow 38959.4/67366: 58% mana berserking, arcane_charge, arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
3:26.213 aoe o arcane_explosion Fluffy_Pillow 38052.0/67366: 56% mana berserking, arcane_charge(2), arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
3:27.394 aoe o arcane_explosion Fluffy_Pillow 37143.1/67366: 55% mana arcane_charge(3), arcane_power, crimson_chorus(3), gladiators_badge
3:28.694 aoe p arcane_barrage Fluffy_Pillow 36394.7/67366: 54% mana arcane_charge(4), arcane_power, crimson_chorus(3), gladiators_badge
3:29.994 aoe n shifting_power Fluffy_Pillow 40840.8/67366: 61% mana crimson_chorus(3)
3:33.662 aoe j touch_of_the_magi Fluffy_Pillow 43282.7/67366: 64% mana social_butterfly
3:34.962 aoe l rune_of_power Fluffy_Pillow 42534.3/67366: 63% mana arcane_charge(4), social_butterfly
3:36.260 aoe p arcane_barrage Fluffy_Pillow 44283.1/67366: 66% mana arcane_charge(4), rune_of_power
3:37.560 aoe m arcane_orb Fluffy_Pillow 48729.2/67366: 72% mana rune_of_power
3:38.862 aoe p arcane_barrage Fluffy_Pillow 49983.4/67366: 74% mana arcane_charge(4), rune_of_power
3:40.161 aoe o arcane_explosion Fluffy_Pillow 54428.2/67366: 81% mana rune_of_power, social_butterfly
3:41.461 aoe o arcane_explosion Fluffy_Pillow 51179.7/67366: 76% mana arcane_charge, rune_of_power, social_butterfly
3:42.760 aoe o arcane_explosion Fluffy_Pillow 47929.9/67366: 71% mana arcane_charge(2), rune_of_power, social_butterfly
3:44.060 aoe o arcane_explosion Fluffy_Pillow 44681.4/67366: 66% mana arcane_charge(3), rune_of_power, social_butterfly
3:45.358 aoe p arcane_barrage Fluffy_Pillow 41430.2/67366: 62% mana arcane_charge(4), rune_of_power
3:46.659 aoe o arcane_explosion Fluffy_Pillow 45877.7/67366: 68% mana rune_of_power
3:47.960 aoe o arcane_explosion Fluffy_Pillow 42630.5/67366: 63% mana arcane_charge, clearcasting, rune_of_power
3:49.260 aoe o arcane_explosion Fluffy_Pillow 44382.0/67366: 66% mana arcane_charge(2)
3:50.560 aoe o arcane_explosion Fluffy_Pillow 41133.5/67366: 61% mana arcane_charge(3), clearcasting, social_butterfly
3:51.859 aoe p arcane_barrage Fluffy_Pillow 42883.7/67366: 64% mana arcane_charge(4), social_butterfly
3:53.158 aoe o arcane_explosion Fluffy_Pillow 47328.5/67366: 70% mana social_butterfly
3:54.457 aoe o arcane_explosion Fluffy_Pillow 44078.7/67366: 65% mana arcane_charge, social_butterfly
3:55.757 aoe o arcane_explosion Fluffy_Pillow 40830.2/67366: 61% mana arcane_charge(2)
3:57.055 aoe o arcane_explosion Fluffy_Pillow 37579.0/67366: 56% mana arcane_charge(3)
3:58.355 aoe p arcane_barrage Fluffy_Pillow 34330.5/67366: 51% mana arcane_charge(4)
3:59.653 aoe m arcane_orb Fluffy_Pillow 38773.9/67366: 58% mana
4:00.953 aoe p arcane_barrage Fluffy_Pillow 40025.4/67366: 59% mana arcane_charge(4), social_butterfly
4:02.253 shared_cds u time_warp Fluffy_Pillow 44471.6/67366: 66% mana social_butterfly
4:02.253 aoe o arcane_explosion Fluffy_Pillow 42471.6/67366: 63% mana temporal_warp, social_butterfly
4:03.254 aoe o arcane_explosion Fluffy_Pillow 38820.2/67366: 58% mana arcane_charge, temporal_warp, crimson_chorus, social_butterfly
4:04.255 aoe o arcane_explosion Fluffy_Pillow 35168.9/67366: 52% mana arcane_charge(2), temporal_warp, crimson_chorus, social_butterfly
4:05.255 aoe o arcane_explosion Fluffy_Pillow 31516.2/67366: 47% mana arcane_charge(3), temporal_warp, crimson_chorus
4:06.255 aoe p arcane_barrage Fluffy_Pillow 27863.5/67366: 41% mana arcane_charge(4), temporal_warp, crimson_chorus
4:07.254 aoe o arcane_explosion Fluffy_Pillow 31904.1/67366: 47% mana temporal_warp, crimson_chorus
4:08.253 aoe o arcane_explosion Fluffy_Pillow 28250.1/67366: 42% mana arcane_charge, temporal_warp, crimson_chorus
4:09.253 aoe o arcane_explosion Fluffy_Pillow 24597.4/67366: 37% mana arcane_charge(2), clearcasting, temporal_warp, crimson_chorus
4:10.255 aoe o arcane_explosion Fluffy_Pillow 25947.4/67366: 39% mana arcane_charge(3), temporal_warp, crimson_chorus, social_butterfly
4:11.256 aoe p arcane_barrage Fluffy_Pillow 22296.1/67366: 33% mana arcane_charge(4), temporal_warp, crimson_chorus, social_butterfly
4:12.256 aoe o arcane_explosion Fluffy_Pillow 26338.0/67366: 39% mana temporal_warp, crimson_chorus(2), social_butterfly
4:13.257 aoe o arcane_explosion Fluffy_Pillow 22686.7/67366: 34% mana arcane_charge, clearcasting, temporal_warp, crimson_chorus(2), social_butterfly
4:14.258 aoe o arcane_explosion Fluffy_Pillow 24035.3/67366: 36% mana arcane_charge(2), temporal_warp, crimson_chorus(2), social_butterfly
4:15.259 aoe n shifting_power Fluffy_Pillow 20384.0/67366: 30% mana arcane_charge(3), temporal_warp, crimson_chorus(2)
4:18.168 aoe o arcane_explosion Fluffy_Pillow 21803.3/67366: 32% mana arcane_charge(3), temporal_warp, crimson_chorus(2)
4:19.169 aoe p arcane_barrage Fluffy_Pillow 18152.0/67366: 27% mana arcane_charge(4), temporal_warp, crimson_chorus(2)
4:20.170 aoe j touch_of_the_magi Fluffy_Pillow 22195.3/67366: 33% mana temporal_warp, crimson_chorus(2), social_butterfly
4:21.171 shared_cds r use_mana_gem NightFae_Dream_SB 21044.0/67366: 31% mana arcane_charge(4), temporal_warp, crimson_chorus(2), social_butterfly
4:21.352 aoe l rune_of_power Fluffy_Pillow 28024.4/67366: 42% mana arcane_charge(4), temporal_warp, crimson_chorus(2), social_butterfly
4:22.351 aoe p arcane_barrage Fluffy_Pillow 29370.4/67366: 44% mana arcane_charge(4), rune_of_power, temporal_warp, crimson_chorus(3), social_butterfly
4:23.353 aoe m arcane_orb Fluffy_Pillow 33415.0/67366: 50% mana rune_of_power, temporal_warp, crimson_chorus(3), social_butterfly
4:24.354 aoe p arcane_barrage Fluffy_Pillow 34263.7/67366: 51% mana arcane_charge(4), rune_of_power, temporal_warp, crimson_chorus(3), social_butterfly
4:25.354 aoe o arcane_explosion Fluffy_Pillow 38305.6/67366: 57% mana rune_of_power, temporal_warp, crimson_chorus(3)
4:26.354 aoe o arcane_explosion Fluffy_Pillow 34652.9/67366: 51% mana arcane_charge, rune_of_power, temporal_warp, crimson_chorus(3)
4:27.355 aoe o arcane_explosion Fluffy_Pillow 31001.6/67366: 46% mana arcane_charge(2), clearcasting, rune_of_power, temporal_warp, crimson_chorus(3)
4:28.357 aoe o arcane_explosion Fluffy_Pillow 32351.6/67366: 48% mana arcane_charge(3), rune_of_power, temporal_warp, crimson_chorus(3)
4:29.357 aoe p arcane_barrage Fluffy_Pillow 28698.9/67366: 43% mana arcane_charge(4), rune_of_power, temporal_warp, crimson_chorus(3)
4:30.358 aoe o arcane_explosion Fluffy_Pillow 32742.2/67366: 49% mana rune_of_power, temporal_warp, crimson_chorus(3), social_butterfly
4:31.358 aoe o arcane_explosion Fluffy_Pillow 29089.5/67366: 43% mana arcane_charge, rune_of_power, temporal_warp, crimson_chorus(3), social_butterfly
4:32.358 aoe o arcane_explosion Fluffy_Pillow 25436.8/67366: 38% mana arcane_charge(2), rune_of_power, temporal_warp, social_butterfly
4:33.360 aoe o arcane_explosion Fluffy_Pillow 21786.8/67366: 32% mana arcane_charge(3), clearcasting, rune_of_power, temporal_warp, social_butterfly
4:34.360 aoe p arcane_barrage Fluffy_Pillow 23134.1/67366: 34% mana arcane_charge(4), temporal_warp, social_butterfly
4:35.361 aoe o arcane_explosion Fluffy_Pillow 27177.4/67366: 40% mana temporal_warp
4:36.363 aoe o arcane_explosion Fluffy_Pillow 23527.4/67366: 35% mana arcane_charge, clearcasting, temporal_warp
4:37.363 aoe o arcane_explosion Fluffy_Pillow 24874.8/67366: 37% mana arcane_charge(2), temporal_warp
4:38.363 aoe o arcane_explosion Fluffy_Pillow 21222.1/67366: 32% mana arcane_charge(3), temporal_warp
4:39.364 aoe p arcane_barrage Fluffy_Pillow 17570.7/67366: 26% mana arcane_charge(4), temporal_warp
4:40.365 aoe o arcane_explosion Fluffy_Pillow 21614.0/67366: 32% mana temporal_warp, social_butterfly
4:41.365 aoe o arcane_explosion Fluffy_Pillow 17961.3/67366: 27% mana arcane_charge, temporal_warp, social_butterfly
4:42.366 aoe o arcane_explosion Fluffy_Pillow 14310.0/67366: 21% mana arcane_charge(2), social_butterfly
4:43.667 aoe o arcane_explosion Fluffy_Pillow 11062.9/67366: 16% mana arcane_charge(3), social_butterfly
4:44.967 aoe p arcane_barrage Fluffy_Pillow 7814.4/67366: 12% mana arcane_charge(4), social_butterfly
4:46.266 aoe m arcane_orb Fluffy_Pillow 12259.2/67366: 18% mana
4:47.567 aoe p arcane_barrage Fluffy_Pillow 13512.0/67366: 20% mana arcane_charge(4)
4:48.867 aoe o arcane_explosion Fluffy_Pillow 17958.1/67366: 27% mana
4:50.167 aoe o arcane_explosion Fluffy_Pillow 14709.7/67366: 22% mana arcane_charge, social_butterfly
4:51.467 aoe o arcane_explosion Fluffy_Pillow 11461.2/67366: 17% mana arcane_charge(2), social_butterfly
4:52.767 aoe o arcane_explosion Fluffy_Pillow 8212.7/67366: 12% mana arcane_charge(3), social_butterfly
4:54.067 aoe k arcane_power Fluffy_Pillow 4964.2/67366: 7% mana arcane_charge(4), social_butterfly
4:54.067 shared_cds s use_items Fluffy_Pillow 4964.2/67366: 7% mana arcane_charge(4), arcane_power, rune_of_power, social_butterfly
4:54.067 aoe p arcane_barrage Fluffy_Pillow 4964.2/67366: 7% mana arcane_charge(4), arcane_power, rune_of_power, social_butterfly, gladiators_badge
4:55.367 aoe o arcane_explosion Fluffy_Pillow 9410.3/67366: 14% mana arcane_power, rune_of_power, gladiators_badge
4:56.666 aoe o arcane_explosion Fluffy_Pillow 8660.5/67366: 13% mana arcane_charge, arcane_power, rune_of_power, gladiators_badge
4:57.966 aoe o arcane_explosion Fluffy_Pillow 7912.0/67366: 12% mana arcane_charge(2), arcane_power, rune_of_power, gladiators_badge
4:59.267 aoe o arcane_explosion Fluffy_Pillow 7164.8/67366: 11% mana arcane_charge(3), arcane_power, rune_of_power, gladiators_badge
5:00.565 aoe p arcane_barrage Fluffy_Pillow 6413.7/67366: 10% mana arcane_charge(4), arcane_power, rune_of_power, social_butterfly, gladiators_badge
5:01.864 shared_cds t potion Fluffy_Pillow 10858.4/67366: 16% mana arcane_power, rune_of_power, social_butterfly, gladiators_badge
5:01.864 aoe o arcane_explosion Fluffy_Pillow 10858.4/67366: 16% mana arcane_power, rune_of_power, social_butterfly, potion_of_deathly_fixation, gladiators_badge
5:03.162 aoe o arcane_explosion Fluffy_Pillow 10107.3/67366: 15% mana arcane_charge, arcane_power, rune_of_power, social_butterfly, potion_of_deathly_fixation, gladiators_badge
5:04.462 aoe o arcane_explosion Fluffy_Pillow 9358.8/67366: 14% mana arcane_charge(2), arcane_power, rune_of_power, crimson_chorus, social_butterfly, potion_of_deathly_fixation, gladiators_badge
5:05.760 aoe o arcane_explosion Fluffy_Pillow 8607.6/67366: 13% mana arcane_charge(3), arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
5:07.060 aoe p arcane_barrage Fluffy_Pillow 7859.1/67366: 12% mana arcane_charge(4), arcane_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
5:08.359 aoe j touch_of_the_magi Fluffy_Pillow 12303.9/67366: 18% mana arcane_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
5:09.659 aoe l rune_of_power Fluffy_Pillow 11555.4/67366: 17% mana arcane_charge(4), crimson_chorus, potion_of_deathly_fixation
5:10.957 aoe p arcane_barrage Fluffy_Pillow 13304.2/67366: 20% mana arcane_charge(4), rune_of_power, crimson_chorus, social_butterfly, potion_of_deathly_fixation
5:12.256 aoe m arcane_orb Fluffy_Pillow 17749.0/67366: 26% mana rune_of_power, crimson_chorus, social_butterfly, potion_of_deathly_fixation
5:13.553 aoe p arcane_barrage Fluffy_Pillow 18996.5/67366: 28% mana arcane_charge(4), rune_of_power, crimson_chorus(2), social_butterfly, potion_of_deathly_fixation
5:14.852 aoe o arcane_explosion Fluffy_Pillow 23441.2/67366: 35% mana rune_of_power, crimson_chorus(2), social_butterfly, potion_of_deathly_fixation
5:16.152 aoe o arcane_explosion Fluffy_Pillow 20192.8/67366: 30% mana arcane_charge, rune_of_power, crimson_chorus(2), potion_of_deathly_fixation
5:17.452 aoe o arcane_explosion Fluffy_Pillow 16944.3/67366: 25% mana arcane_charge(2), rune_of_power, crimson_chorus(2), potion_of_deathly_fixation
5:18.751 aoe o arcane_explosion Fluffy_Pillow 13694.4/67366: 20% mana arcane_charge(3), rune_of_power, crimson_chorus(2), potion_of_deathly_fixation
5:20.052 aoe p arcane_barrage Fluffy_Pillow 10447.3/67366: 16% mana arcane_charge(4), rune_of_power, crimson_chorus(2), social_butterfly, potion_of_deathly_fixation
5:21.352 aoe o arcane_explosion Fluffy_Pillow 14893.4/67366: 22% mana rune_of_power, crimson_chorus(2), social_butterfly, potion_of_deathly_fixation
5:22.651 aoe o arcane_explosion Fluffy_Pillow 11643.6/67366: 17% mana arcane_charge, rune_of_power, crimson_chorus(2), social_butterfly, potion_of_deathly_fixation
5:23.951 aoe n shifting_power Fluffy_Pillow 8395.1/67366: 12% mana arcane_charge(2), crimson_chorus(3), social_butterfly, potion_of_deathly_fixation
5:27.490 aoe o arcane_explosion Fluffy_Pillow 10663.2/67366: 16% mana arcane_charge(2), crimson_chorus(3)
5:28.792 aoe o arcane_explosion Fluffy_Pillow 7417.4/67366: 11% mana arcane_charge(3), clearcasting, crimson_chorus(3)
5:30.092 aoe p arcane_barrage Fluffy_Pillow 9168.9/67366: 14% mana arcane_charge(4), crimson_chorus(3), social_butterfly
5:31.392 aoe m arcane_orb Fluffy_Pillow 13615.1/67366: 20% mana crimson_chorus(3), social_butterfly
5:32.690 aoe p arcane_barrage Fluffy_Pillow 14863.9/67366: 22% mana arcane_charge(4), crimson_chorus(3), social_butterfly
5:33.990 aoe o arcane_explosion Fluffy_Pillow 19310.0/67366: 29% mana social_butterfly
5:35.291 aoe o arcane_explosion Fluffy_Pillow 16062.9/67366: 24% mana arcane_charge
5:36.591 aoe o arcane_explosion Fluffy_Pillow 12814.4/67366: 19% mana arcane_charge(2), clearcasting
5:37.891 aoe o arcane_explosion Fluffy_Pillow 14565.9/67366: 22% mana arcane_charge(3)
5:39.192 aoe p arcane_barrage Fluffy_Pillow 11318.8/67366: 17% mana arcane_charge(4)
5:40.492 aoe o arcane_explosion Fluffy_Pillow 15764.9/67366: 23% mana social_butterfly
5:41.790 aoe o arcane_explosion Fluffy_Pillow 12513.7/67366: 19% mana arcane_charge, social_butterfly
5:43.091 aoe j touch_of_the_magi Fluffy_Pillow 9266.6/67366: 14% mana arcane_charge(2), clearcasting, social_butterfly
5:44.390 aoe l rune_of_power Fluffy_Pillow 8516.7/67366: 13% mana arcane_charge(4), clearcasting, social_butterfly
5:45.690 aoe p arcane_barrage Fluffy_Pillow 10268.2/67366: 15% mana arcane_charge(4), clearcasting, rune_of_power
5:46.989 aoe o arcane_explosion Fluffy_Pillow 14713.0/67366: 22% mana clearcasting, rune_of_power
5:48.286 aoe o arcane_explosion Fluffy_Pillow 16460.5/67366: 24% mana arcane_charge, rune_of_power
5:49.585 aoe o arcane_explosion Fluffy_Pillow 13210.7/67366: 20% mana arcane_charge(2), rune_of_power

Stats

Level Bonus (60) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 198 1 199 199 0
Agility 306 2 308 308 0
Stamina 414 0 2013 1918 1504
Intellect 450 -3 1767 1588 1066 (46)
Spirit 0 0 0 0 0
Health 40260 38360 0
Mana 67366 67366 0
Spell Power 1767 1588 0
Crit 15.74% 15.74% 376
Haste 15.76% 15.76% 520
Versatility 7.97% 7.97% 319
Mana Regen 1347 1347 0
Mastery 34.73% 34.73% 733
Armor 369 369 369
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 227.00
Local Head Confidant's Favored Cap
ilevel: 226, stats: { 44 Armor, +82 Int, +149 Sta, +44 Haste, +98 Mastery }
Local Neck Noble's Birthstone Pendant
ilevel: 226, stats: { +84 Sta, +52 Crit, +162 Mastery }
Local Shoulders Shawl of the Penitent
ilevel: 233, stats: { 42 Armor, +65 Int, +122 Sta, +33 Crit, +76 Haste }
Local Chest Robes of the Cursed Commando
ilevel: 233, stats: { 61 Armor, +87 Int, +162 Sta, +47 Crit, +100 Haste }, enchant: { +20 Int }
Local Waist Cinch of Infinite Tightness
ilevel: 226, stats: { 33 Armor, +61 Int, +112 Sta, +69 Crit, +36 Vers }
Local Legs Courtier's Costume Trousers
ilevel: 226, stats: { 51 Armor, +82 Int, +149 Sta, +49 Vers, +93 Mastery }
Local Feet Slippers of the Forgotten Heretic
ilevel: 226, stats: { 36 Armor, +61 Int, +112 Sta, +73 Crit, +32 Mastery }
Local Wrists Acolyte's Velvet Bindings
ilevel: 226, stats: { 29 Armor, +46 Int, +84 Sta, +26 Vers, +53 Mastery }, enchant: { +15 Int }
Local Hands Impossibly Oversized Mitts
ilevel: 226, stats: { 33 Armor, +61 Int, +112 Sta, +31 Haste, +74 Mastery }
Local Finger1 Most Regal Signet of Sire Denathrius
ilevel: 233, stats: { +91 Sta, +178 Haste, +48 Mastery }, enchant: { +16 Mastery }
item effects: { equip: Denathrius' Privilege }
Local Finger2 Shadowghast Ring
ilevel: 235, stats: { +94 Sta, +115 Mastery, +115 Vers }, enchant: { +16 Mastery }
item effects: { equip: Temporal Warp }
Local Trinket1 Cabalist's Hymnal
ilevel: 226, stats: { +77 Int }
item effects: { equip: Crimson Chorus }
Local Trinket2 Sinful Aspirant's Badge of Ferocity
ilevel: 207, stats: { +91 Haste }
item effects: { use: Gladiator's Badge }
Local Back Mantle of Manifest Sins
ilevel: 226, stats: { 40 Armor, +84 Sta, +53 Crit, +26 Mastery, +46 StrAgiInt }
Local Main Hand Staff of the Penitent
ilevel: 226, weapon: { 93 - 128, 3.6 }, stats: { +82 Int, +281 Int, +149 Sta, +49 Crit, +93 Vers }, enchant: sinful_revelation

Profile

mage="NightFae_Dream_SB"
source=default
spec=arcane
level=60
race=troll
role=spell
position=back
talents=1031021
talent_override=resonance,if=3>2
covenant=night_fae
soulbind=319210//51:6

# Default consumables
potion=deathly_fixation
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=variable,name=prepull_evo,op=reset,default=0
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
actions.precombat+=/variable,name=have_opened,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
actions.precombat+=/variable,name=final_burn,op=set,value=0
actions.precombat+=/variable,name=rs_max_delay,op=reset,default=5
actions.precombat+=/variable,name=ap_max_delay,op=reset,default=10
actions.precombat+=/variable,name=rop_max_delay,op=reset,default=20
actions.precombat+=/variable,name=totm_max_delay,op=reset,default=5
actions.precombat+=/variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
actions.precombat+=/variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
actions.precombat+=/variable,name=barrage_mana_pct,op=reset,default=70
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=reset,default=30
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
actions.precombat+=/variable,name=totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=aoe_totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=am_spam,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
actions.precombat+=/variable,name=am_spam_evo_pct,op=reset,default=15
actions.precombat+=/flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_familiar
actions.precombat+=/arcane_intellect
actions.precombat+=/conjure_mana_gem
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/frostbolt,if=variable.prepull_evo<=0
actions.precombat+=/evocation,if=variable.prepull_evo>0

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/call_action_list,name=shared_cds
actions+=/call_action_list,name=essences
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/call_action_list,name=opener,if=variable.have_opened<=0
actions+=/call_action_list,name=am_spam,if=variable.am_spam=1
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=rotation,if=variable.final_burn=0
actions+=/call_action_list,name=final_burn,if=variable.final_burn=1
actions+=/call_action_list,name=movement

actions.am_spam=cancel_action,if=action.evocation.channeling&mana.pct>=95
actions.am_spam+=/evocation,if=mana.pct<=variable.am_spam_evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/rune_of_power,if=buff.rune_of_power.down&cooldown.arcane_power.remains>0
actions.am_spam+=/touch_of_the_magi,if=(cooldown.arcane_power.remains=0&buff.rune_of_power.down)|prev_gcd.1.rune_of_power
actions.am_spam+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&buff.rune_of_power.down&essence.vision_of_perfection.enabled
actions.am_spam+=/arcane_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.ap_max_delay
actions.am_spam+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=action.arcane_missiles.execute_time&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_barrage,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_missiles,if=buff.clearcasting.react,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/arcane_missiles,if=!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.am_spam+=/arcane_barrage
actions.am_spam+=/arcane_blast

actions.aoe=frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
actions.aoe+=/arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
actions.aoe+=/mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
actions.aoe+=/arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
actions.aoe+=/rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
actions.aoe+=/presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
actions.aoe+=/arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
actions.aoe+=/supernova
actions.aoe+=/arcane_orb,if=buff.arcane_charge.stack=0
actions.aoe+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
actions.aoe+=/arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1

# Prioritize using grisly icicle with ap. Use it with totm otherwise.
actions.cooldowns=frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.cooldowns+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
# Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
# Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
actions.cooldowns+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
# Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
# Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
# Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
actions.cooldowns+=/arcane_power,if=(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
actions.cooldowns+=/rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
# Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
actions.cooldowns+=/presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
# Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.cooldowns+=/presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled

actions.essences=blood_of_the_enemy,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/blood_of_the_enemy,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains>=50&cooldown.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay
actions.essences+=/worldvein_resonance,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/guardian_of_azeroth,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/guardian_of_azeroth,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/concentrated_flame,line_cd=6,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/reaping_flames,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/focused_azerite_beam,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/purifying_blast,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/ripple_in_space,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/the_unbound_force,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/memory_of_lucid_dreams,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down

actions.final_burn=arcane_missiles,if=buff.clearcasting.react,chain=1
actions.final_burn+=/arcane_blast
actions.final_burn+=/arcane_barrage

actions.movement=blink_any,if=movement.distance>=10
actions.movement+=/presence_of_mind
actions.movement+=/arcane_missiles,if=movement.distance<10
actions.movement+=/arcane_orb
actions.movement+=/fire_blast

actions.opener=variable,name=have_opened,op=set,value=1,if=prev_gcd.1.evocation
actions.opener+=/fire_blast,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command_frost.up
actions.opener+=/frost_nova,if=runeforge.grisly_icicle.equipped&mana.pct>95
actions.opener+=/mirrors_of_torment
actions.opener+=/deathborne
actions.opener+=/radiant_spark,if=mana.pct>40
actions.opener+=/cancel_action,if=action.shifting_power.channeling&gcd.remains=0
actions.opener+=/shifting_power,if=soulbind.field_of_blossoms.enabled
actions.opener+=/touch_of_the_magi
actions.opener+=/arcane_power
actions.opener+=/rune_of_power,if=buff.rune_of_power.down
actions.opener+=/presence_of_mind
actions.opener+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.opener+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.opener+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.opener+=/arcane_missiles,if=buff.clearcasting.react,chain=1
actions.opener+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges&(cooldown.arcane_power.remains>10|active_enemies<=2)
actions.opener+=/arcane_blast,if=buff.rune_of_power.up|mana.pct>15
actions.opener+=/evocation,if=buff.rune_of_power.down,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.opener+=/arcane_barrage

actions.rotation=variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
actions.rotation+=/strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
actions.rotation+=/arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
actions.rotation+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.rotation+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.rotation+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
actions.rotation+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
actions.rotation+=/supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.rotation+=/arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
actions.rotation+=/arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_blast
actions.rotation+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.rotation+=/arcane_barrage

actions.shared_cds=use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
actions.shared_cds+=/use_items,if=buff.arcane_power.up
actions.shared_cds+=/potion,if=buff.arcane_power.up
actions.shared_cds+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
actions.shared_cds+=/lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/berserking,if=buff.arcane_power.up
actions.shared_cds+=/blood_fury,if=buff.arcane_power.up
actions.shared_cds+=/fireblood,if=buff.arcane_power.up
actions.shared_cds+=/ancestral_call,if=buff.arcane_power.up

head=confidants_favored_cap,id=183021,bonus_id=1498,ilevel=226
neck=nobles_birthstone_pendant,id=183039,bonus_id=1498,ilevel=226
shoulders=shawl_of_the_penitent,id=183020,bonus_id=1498,ilevel=233
back=mantle_of_manifest_sins,id=183033,bonus_id=1498,ilevel=226
chest=robes_of_the_cursed_commando,id=182998,bonus_id=1498,ilevel=233,enchant=eternal_insight
wrists=acolytes_velvet_bindings,id=183017,bonus_id=1498,ilevel=226,enchant=eternal_intellect
hands=impossibly_oversized_mitts,id=183022,bonus_id=1498,ilevel=226
waist=cinch_of_infinite_tightness,id=183028,bonus_id=1498,ilevel=226
legs=courtiers_costume_trousers,id=183011,bonus_id=1498,ilevel=226
feet=slippers_of_the_forgotten_heretic,id=182979,bonus_id=1498,ilevel=226
finger1=most_regal_signet_of_sire_denathrius,id=183036,bonus_id=1498,ilevel=233,enchant=16mastery
finger2=shadowghast_ring,id=178926,bonus_id=6648/6650/6758/6834/1532,ilevel=235,enchant=16mastery
trinket1=cabalists_hymnal,id=184028,bonus_id=1498,ilevel=226
trinket2=sinful_aspirants_badge_of_ferocity,id=175884,bonus_id=1521,ilevel=207
main_hand=staff_of_the_penitent,id=180000,bonus_id=7187/6652/1524,ilevel=226,enchant=sinful_revelation

# Gear Summary
# gear_ilvl=226.73
# gear_stamina=1504
# gear_intellect=1066
# gear_crit_rating=376
# gear_haste_rating=520
# gear_mastery_rating=733
# gear_versatility_rating=319
# gear_armor=369

NightFae_Koraylon : 9284 dps, 3910 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
9283.7 9283.7 11.1 / 0.119% 825.1 / 8.9% 4.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
2081.0 1975.1 Mana 0.00% 52.9 100.0% 100%
Talents
Night Fae
Runeforge

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
NightFae_Koraylon 9284
Arcane Barrage 3431 37.0% 58.7 5.12sec 17518 15268 Direct 175.8 4919 9923 5847 18.6%

Stats Details: Arcane Barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 58.68 175.82 0.00 0.00 1.1473 0.0000 1028033.50 1028033.50 0.00% 15268.35 15268.35
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.45% 143.20 104 181 4918.79 2155 16004 4923.55 4475 5312 704542 704542 0.00%
crit 18.55% 32.62 11 52 9923.15 4309 32009 9920.69 6881 13183 323491 323491 0.00%

Action Details: Arcane Barrage

  • id:44425
  • school:arcane
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.728000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=0 + 72.8%} Arcane damage. For each Arcane Charge, deals {$36032s2=30}% additional damage$?a321526[, grants you {$321526s1=2}% of your maximum mana,][]$?a231564[ and hits {$36032s3=0} additional nearby $Ltarget:targets; for {$s2=40}% of its damage][]. |cFFFFFFFFConsumes all Arcane Charges.|r

Action Priority List

    aoe
    [p]:58.69
  • if_expr:buff.arcane_charge.stack=buff.arcane_charge.max_stack
Arcane Explosion 3941 42.5% 155.6 1.91sec 7589 6658 Direct 466.8 2126 4292 2530 18.6%

Stats Details: Arcane Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 155.61 466.82 0.00 0.00 1.1400 0.0000 1180980.07 1180980.07 0.00% 6657.65 6657.65
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.36% 379.82 286 468 2125.89 1427 4241 2126.94 2016 2254 807511 807511 0.00%
crit 18.64% 87.00 47 128 4292.07 2855 8481 4295.23 3724 5012 373469 373469 0.00%

Action Details: Arcane Explosion

  • id:1449
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.502320
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s2=0 + 50.2%} Arcane damage to all enemies within $A2 yards.$?a137021[ |cFFFFFFFFGenerates {$s1=1} Arcane Charge if any targets are hit.|r][]

Action Priority List

    aoe
    [o]:155.64
  • if_expr:buff.arcane_charge.stack<buff.arcane_charge.max_stack
Arcane Orb 0 (748) 0.0% (8.0%) 14.2 21.66sec 15750 13640

Stats Details: Arcane Orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.20 0.00 0.00 0.00 1.1547 0.0000 0.00 0.00 0.00% 13640.33 13640.33

Action Details: Arcane Orb

  • id:153626
  • school:arcane
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:153626
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r

Action Priority List

    aoe
    [m]:14.20
  • if_expr:buff.arcane_charge.stack=0
    Arcane Orb (_bolt) 748 8.0% 42.5 21.65sec 5258 0 Direct 42.5 4424 8829 5257 18.9%

Stats Details: Arcane Orb Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 42.53 42.53 0.00 0.00 0.0000 0.0000 223619.52 223619.52 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.09% 34.49 22 47 4424.45 2821 8381 4429.89 3750 4937 152589 152589 0.00%
crit 18.91% 8.04 2 18 8828.69 5642 16761 8842.21 5642 15094 71031 71031 0.00%

Action Details: Arcane Orb Bolt

  • id:153640
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.092000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:153640
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:{$@spelldesc153626=Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r}
Deathly Fixation 0 (112) 0.0% (1.2%) 22.8 7.47sec 1485 0

Stats Details: Deathly Fixation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 22.75 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Deathly Fixation

  • id:322253
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:42.90
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322253
  • name:Deathly Fixation
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1.
  • description:Deal {$s1=43} Shadow damage every $t1. Stacks up to 5 times.
    Deathly Eruption 112 1.2% 22.8 7.47sec 1485 0 Direct 22.8 1231 2464 1485 20.6%

Stats Details: Deathly Eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 22.75 22.75 0.00 0.00 0.0000 0.0000 33776.62 33776.62 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.44% 18.07 6 32 1231.29 1117 1302 1234.94 1177 1302 22249 22249 0.00%
crit 20.56% 4.68 0 14 2464.32 2233 2604 2443.61 0 2604 11528 11528 0.00%

Action Details: Deathly Eruption

  • id:322256
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:984.99
  • base_dd_max:984.99
  • base_dd_mult:1.00

Spelldata

  • id:322256
  • name:Deathly Eruption
  • school:shadow
  • tooltip:
  • description:Deal {$s1=985} Shadow damage.
Eternal Insight 41 0.4% 21.8 13.56sec 568 0 Direct 21.8 478 957 568 18.9%

Stats Details: Eternal Insight

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 21.79 21.79 0.00 0.00 0.0000 0.0000 12384.45 12384.45 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.14% 17.68 6 33 477.98 453 529 477.96 458 498 8451 8451 0.00%
crit 18.86% 4.11 0 11 957.00 907 1058 940.67 0 1058 3933 3933 0.00%

Action Details: Eternal Insight

  • id:342314
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:400.00
  • base_dd_max:400.00
  • base_dd_mult:1.00

Spelldata

  • id:342314
  • name:Eternal Insight
  • school:shadow
  • tooltip:
  • description:Deals {$s1=400} Shadow damage.
Frostbolt 4 0.0% 0.0 0.00sec 0 0 Direct 1.0 1126 2252 1291 14.7%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 1.00 0.00 0.00 0.0000 0.0000 1291.69 1291.69 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 85.29% 0.85 0 1 1126.06 1126 1126 960.44 0 1126 960 960 0.00%
crit 14.71% 0.15 0 1 2252.13 2252 2252 331.25 0 2252 331 331 0.00%

Action Details: Frostbolt

  • id:116
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.511000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116
  • name:Frostbolt
  • school:frost
  • tooltip:
  • description:Launches a bolt of frost at the enemy, causing {$228597s1=0} Frost damage and slowing movement speed by {$205708s1=50}% for {$205708d=8 seconds}.
Mirror Image 0 (19) 0.0% (0.2%) 1.0 0.00sec 5691 0

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.
    Frostbolt (mirror_image) 142  / 19 0.2% 117.0 0.99sec 49 48 Direct 117.0 41 82 49 19.8%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 117.00 117.00 0.00 0.00 1.0091 0.0000 5691.45 5691.45 0.00% 48.21 48.21
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.23% 93.87 80 107 40.55 30 51 40.55 39 42 3806 3806 0.00%
crit 19.77% 23.13 10 37 81.51 59 101 81.54 71 93 1885 1885 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:40.00
Shifting Power 285 3.1% 6.1 47.99sec 13992 4179 Periodic 72.9 980 1972 1172 19.4% 2.1%

Stats Details: Shifting Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.11 0.00 24.29 72.88 3.3484 0.7787 85448.08 85448.08 0.00% 4178.80 4178.80
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.62% 58.76 40 76 980.32 949 1106 980.02 959 1002 57602 57602 0.00%
crit 19.38% 14.12 3 31 1971.64 1898 2213 1971.34 1898 2070 27846 27846 0.00%

Action Details: Shifting Power

  • id:314791
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:4.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:314791
  • name:Shifting Power
  • school:nature
  • tooltip:Every $t1 sec, deal {$325130s1=0} Nature damage to enemies within $325130A1 yds and reduce the remaining cooldown of your abilities by ${-{$s2=3000}/1000} sec.
  • description:Draw power from the ground beneath, dealing ${{$325130s1=0}*{$d=4 seconds}/$t} Nature damage over {$d=4 seconds} to enemies within $325130A1 yds. While channeling, your Mage ability cooldowns are reduced by ${-{$s2=3000}/1000*{$d=4 seconds}/$t} sec over {$d=4 seconds}.

Action Details: Shifting Power Pulse

  • id:325130
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:18.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.473600
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:325130
  • name:Shifting Power
  • school:nature
  • tooltip:
  • description:{$@spelldesc314791=Draw power from the ground beneath, dealing ${{$325130s1=0}*{$d=4 seconds}/$t} Nature damage over {$d=4 seconds} to enemies within $325130A1 yds. While channeling, your Mage ability cooldowns are reduced by ${-{$s2=3000}/1000*{$d=4 seconds}/$t} sec over {$d=4 seconds}.}

Action Priority List

    aoe
    [n]:6.11
  • if_expr:buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
Touch of the Magi 0 (702) 0.0% (7.6%) 7.0 45.77sec 29926 23707

Stats Details: Touch Of The Magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 7.02 0.00 0.00 0.00 1.2624 0.0000 0.00 0.00 0.00% 23706.64 23706.64

Action Details: Touch Of The Magi

  • id:321507
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:4.0

Spelldata

  • id:321507
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]

Action Priority List

    aoe
    [j]:7.05
  • if_expr:buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
    Touch of the Magi (_explosion) 702 7.6% 7.0 45.63sec 29926 0 Direct 21.0 10037 0 10037 0.0%

Stats Details: Touch Of The Magi Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 7.02 20.95 0.00 0.00 0.0000 0.0000 210206.76 210206.76 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 20.95 15 27 10037.26 1480 49882 10132.26 7340 13958 210207 210207 0.00%

Action Details: Touch Of The Magi Explosion

  • id:210833
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14279.70
  • base_dd_max:14279.70
  • base_dd_mult:1.00

Spelldata

  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc321507=Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]}
Simple Action Stats Execute Interval
NightFae_Koraylon
Arcane Power 3.6 97.60sec

Stats Details: Arcane Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.55 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Power

  • id:12042
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].

Action Priority List

    aoe
    [k]:3.56
  • if_expr:((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
Berserking 2.0 194.96sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    shared_cds
    [v]:2.00
  • if_expr:buff.arcane_power.up
Conjure Mana Gem 1.0 0.00sec

Stats Details: Conjure Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Conjure Mana Gem

  • id:759
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:9000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:759
  • name:Conjure Mana Gem
  • school:arcane
  • tooltip:
  • description:Conjures a Mana Gem that can be used to instantly restore {$5405s1=10}% mana, and holds up to {$s2=3} charges. $@spellname118812 {$@spelldesc118812=Conjured items disappear if logged out for more than 15 minutes.}
Evocation 0.4 197.21sec

Stats Details: Evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.42 0.00 2.50 0.00 3.7469 0.6351 0.00 0.00 0.00% 0.00 0.00

Action Details: Evocation

  • id:12051
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Koraylon
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.

Action Priority List

    aoe
    [q]:0.43
  • interrupt_if_expr:mana.pct>=85
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Koraylon
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Koraylon
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Deathly Fixation (potion) 1.5 300.50sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.49 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307497
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    shared_cds
    [t]:1.48
  • if_expr:buff.arcane_power.up
Rune of Power 6.9 44.01sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.93 0.00 0.00 0.00 1.1860 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    aoe
    [l]:6.96
  • if_expr:buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Time Warp 2.0 240.34sec

Stats Details: Time Warp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.99 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Time Warp

  • id:80353
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:2000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:80353
  • name:Time Warp
  • school:arcane
  • tooltip:Haste increased by $w1%. $?$W4>0[Time rate increased by $w4%.][]$?$W3=1[ When the effect ends, you die.][]
  • description:Warp the flow of time, increasing haste by {$s1=30}% $?a320919[and time rate by {$s4=0}% ][]for all party and raid members for {$d=40 seconds}. Allies will be unable to benefit from Bloodlust, Heroism, or Time Warp again for {$57724d=600 seconds}.$?a320920[ When the effect ends, you die.][]

Action Priority List

    shared_cds
    [u]:1.99
  • if_expr:runeforge.temporal_warp.equipped&buff.exhaustion.up
Replenish Mana (use_mana_gem) 2.8 121.42sec

Stats Details: Use Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.83 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Use Mana Gem

  • id:5405
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Koraylon
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5405
  • name:Replenish Mana
  • school:physical
  • tooltip:Restoring $w2 mana every $t1 sec.
  • description:Restores {$s1=10}% mana.

Action Priority List

    shared_cds
    [r]:2.84
  • if_expr:(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Arcane Charge 59.4 159.9 5.1sec 1.4sec 3.7sec 73.76% 0.00% 2.7 (3.8) 0.0

Buff Details

  • buff initial source:NightFae_Koraylon
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.8s / 15.9s
  • trigger_min/max:0.0s / 9.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 13.4s

Stack Uptimes

  • arcane_charge_1:18.82%
  • arcane_charge_2:16.27%
  • arcane_charge_3:17.19%
  • arcane_charge_4:21.47%

Spelldata

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 3.6 0.0 97.6sec 97.6sec 14.7sec 17.42% 0.00% 0.0 (0.0) 3.4

Buff Details

  • buff initial source:NightFae_Koraylon
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:96.0s / 115.3s
  • trigger_min/max:96.0s / 115.3s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 15.0s

Stack Uptimes

  • arcane_power_1:17.42%

Spelldata

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Berserking 2.0 0.0 195.1sec 195.1sec 12.0sec 8.11% 6.52% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:NightFae_Koraylon
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:192.6s / 201.2s
  • trigger_min/max:192.6s / 201.2s
  • trigger_pct:100.00%
  • duration_min/max:12.0s / 12.0s

Stack Uptimes

  • berserking_1:8.11%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.51% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:NightFae_Koraylon
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.51%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Clearcasting 24.7 0.2 11.8sec 11.7sec 2.0sec 16.84% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:NightFae_Koraylon
  • cooldown name:buff_clearcasting
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • clearcasting_1:16.56%
  • clearcasting_2:0.29%
  • clearcasting_3:0.04%

Spelldata

  • id:263725
  • name:Clearcasting
  • tooltip:Your next Arcane Missiles or Arcane Explosion costs no mana{$?s321758=false}[ and Arcane Missiles fires an additional missile][].
  • description:{$@spelldesc79684=For each ${$c*100/{$s1=200}} mana you spend, you have a 1% chance to gain Clearcasting, making your next Arcane Missiles or Arcane Explosion free and channel {$277726s1=20}% faster.$?a321758[ Arcane Missiles fires {$321758s2=1} additional missile.][]}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Crimson Chorus 5.5 0.0 60.6sec 60.6sec 28.6sec 52.02% 0.00% 0.0 (0.0) 4.9

Buff Details

  • buff initial source:NightFae_Koraylon
  • cooldown name:buff_crimson_chorus
  • max_stacks:3
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:60.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:10.00
  • associated item:Cabalist's Hymnal

Stat Details

  • stat:crit_rating
  • amount:95.00

Trigger Details

  • interval_min/max:60.0s / 66.3s
  • trigger_min/max:60.0s / 66.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • crimson_chorus_1:17.94%
  • crimson_chorus_2:17.33%
  • crimson_chorus_3:16.75%

Spelldata

  • id:344803
  • name:Crimson Chorus
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc344806=Join the Crimson Chorus. Every minute, your Critical Strike swells by ${{$s1=44}*3} over ${{$344803d=10 seconds}*3} sec. before returning to normal. This effect is increased by {$s2=5}% for each member of the Crimson Chorus in your party.}
  • max_stacks:3
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Evocation 0.4 0.0 191.5sec 191.5sec 3.7sec 0.52% 0.00% 1.7 (1.7) 0.0

Buff Details

  • buff initial source:NightFae_Koraylon
  • cooldown name:buff_evocation
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:7.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:1.00

Trigger Details

  • interval_min/max:187.5s / 209.9s
  • trigger_min/max:187.5s / 209.9s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 4.3s

Stack Uptimes

  • evocation_1:0.52%

Spelldata

  • id:12051
  • name:Evocation
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Gladiator's Badge 3.6 0.0 97.6sec 97.6sec 14.7sec 17.42% 0.00% 0.0 (0.0) 3.4

Buff Details

  • buff initial source:NightFae_Koraylon
  • cooldown name:buff_gladiators_badge
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Sinful Aspirant's Badge of Ferocity

Stat Details

  • stat:intellect
  • amount:342.00

Trigger Details

  • interval_min/max:96.0s / 115.3s
  • trigger_min/max:96.0s / 115.3s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 15.0s

Stack Uptimes

  • gladiators_badge_1:17.42%

Spelldata

  • id:345228
  • name:Gladiator's Badge
  • tooltip:Primary stat increased by $w1.
  • description:Increases primary stat by {$s1=252} for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:0.00%
Potion of Deathly Fixation 1.5 0.0 300.5sec 300.5sec 23.2sec 11.27% 0.00% 0.0 (0.0) 1.3

Buff Details

  • buff initial source:NightFae_Koraylon
  • cooldown name:buff_potion_of_deathly_fixation
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:300.0s / 308.4s
  • trigger_min/max:300.0s / 308.4s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 25.0s

Stack Uptimes

  • potion_of_deathly_fixation_1:11.27%

Spelldata

  • id:307497
  • name:Potion of Deathly Fixation
  • tooltip:Chance to apply Deathly Fixation to your target.
  • description:Your damaging spells and abilities have a chance to apply Deathly Fixation to your target, dealing {$322253s1=43} Shadow damage over {$322253d=8 seconds} and stacking up to 5 times. Upon reaching 5 stacks, Deathly Fixation explodes, dealing {$322256s1=985} Shadow damage to the target. If you consume this potion while your weapon is augmented with Shadowcore Oil, the explosion damage is increased by {$s2=10}%. Lasts {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Rune of Power 10.5 0.0 29.6sec 29.6sec 11.8sec 41.13% 0.00% 0.0 (0.0) 10.1

Buff Details

  • buff initial source:NightFae_Koraylon
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.0s / 55.1s
  • trigger_min/max:13.0s / 55.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • rune_of_power_1:41.13%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Temporal Warp 2.0 0.0 240.4sec 240.4sec 36.8sec 24.25% 0.00% 0.0 (0.0) 1.7

Buff Details

  • buff initial source:NightFae_Koraylon
  • cooldown name:buff_temporal_warp
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:240.0s / 241.0s
  • trigger_min/max:240.0s / 241.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 40.0s

Stack Uptimes

  • temporal_warp_1:24.25%

Spelldata

  • id:327355
  • name:Temporal Warp
  • tooltip:Haste increased by $w1%.
  • description:{$@spelldesc327351=While you have Temporal Displacement or other similar effects, you may use Time Warp to grant yourself {$327355s1=30}% Haste for {$327355d=40 seconds}.}
  • max_stacks:0
  • duration:40.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism)

Buff Details

  • buff initial source:NightFae_Koraylon
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power

Buff Details

  • buff initial source:NightFae_Koraylon
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Benefit Avg % Min Max
Arcane Barrage Arcane Charge 4 100.00% 100.00% 100.00%
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 1.17% 0.35% 7.03% 0.8s 0.0s 5.0s
Conserve Phase 100.00% 100.00% 100.00% 299.9s 240.2s 360.0s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.0000.0000.000203.943144.203263.964
Evocation227.33255.094342.695279.165162.372359.964
Rune of Power8.3190.00237.70759.55121.352113.014
Touch of the Magi7.3920.00022.11753.25816.940110.494
Arcane Power1.5450.00019.2845.5251.89321.732
Arcane Barrage2.8310.00012.079167.341133.384201.408
Arcane Orb3.7320.00011.40953.52734.72971.119
Shifting Power6.9970.00037.11144.19529.70867.900
Time Warp0.8350.0001.3031.6601.2972.347

Burn Phases

Burn phase duration tracks the amount of time spent in each burn phase. This is defined as the time between a start_burn_phase and stop_burn_phase action being executed. Note that "execute" burn phases, i.e., the final burn of a fight, is also included.

Burn Phase Duration
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Mana at burn start is the mana level recorded (in percentage of total mana) when a start_burn_phase command is executed.

Mana at Burn Start
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
NightFae_Koraylon
mana_regen Mana 685.52 397999.88 67.17% 580.58 5573.09 1.38%
Evocation Mana 17.96 21721.38 3.67% 1209.46 0.00 0.00%
Mana Gem Mana 2.84 19109.66 3.23% 6736.57 0.00 0.00%
Arcane Barrage Mana 58.69 153702.24 25.94% 2619.06 4435.11 2.80%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 66365.7 1975.08 2080.95 10052.8 35610.4 156.4 67365.7
Usage Type Count Total Avg RPE APR
NightFae_Koraylon
arcane_explosion Mana 155.6 580176.0 3727.8 3728.5 2.0
arcane_orb Mana 14.2 6302.1 443.9 443.9 35.5
shifting_power Mana 6.1 15264.0 2500.0 2499.5 5.6
time_warp Mana 2.0 3974.5 2000.0 2000.2 0.0
touch_of_the_magi Mana 7.0 17537.5 2496.8 2496.7 12.0

Statistics & Data Analysis

Fight Length
NightFae_Koraylon Fight Length
Count 1319
Mean 299.94
Minimum 240.20
Maximum 359.96
Spread ( max - min ) 119.76
Range [ ( max - min ) / 2 * 100% ] 19.96%
DPS
NightFae_Koraylon Damage Per Second
Count 1319
Mean 9283.74
Minimum 8667.66
Maximum 9902.17
Spread ( max - min ) 1234.50
Range [ ( max - min ) / 2 * 100% ] 6.65%
Standard Deviation 205.0886
5th Percentile 8942.30
95th Percentile 9624.59
( 95th Percentile - 5th Percentile ) 682.30
Mean Distribution
Standard Deviation 5.6470
95.00% Confidence Interval ( 9272.67 - 9294.81 )
Normalized 95.00% Confidence Interval ( 99.88% - 100.12% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 19
0.1% Error 1875
0.1 Scale Factor Error with Delta=300 360
0.05 Scale Factor Error with Delta=300 1437
0.01 Scale Factor Error with Delta=300 35906
Priority Target DPS
NightFae_Koraylon Priority Target Damage Per Second
Count 1319
Mean 3909.97
Minimum 3583.85
Maximum 4345.03
Spread ( max - min ) 761.19
Range [ ( max - min ) / 2 * 100% ] 9.73%
Standard Deviation 125.4702
5th Percentile 3708.76
95th Percentile 4132.87
( 95th Percentile - 5th Percentile ) 424.11
Mean Distribution
Standard Deviation 3.4548
95.00% Confidence Interval ( 3903.19 - 3916.74 )
Normalized 95.00% Confidence Interval ( 99.83% - 100.17% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 40
0.1% Error 3956
0.1 Scale Factor Error with Delta=300 135
0.05 Scale Factor Error with Delta=300 538
0.01 Scale Factor Error with Delta=300 13439
DPS(e)
NightFae_Koraylon Damage Per Second (Effective)
Count 1319
Mean 9283.74
Minimum 8667.66
Maximum 9902.17
Spread ( max - min ) 1234.50
Range [ ( max - min ) / 2 * 100% ] 6.65%
Damage
NightFae_Koraylon Damage
Count 1319
Mean 2775740.68
Minimum 2195759.43
Maximum 3368454.92
Spread ( max - min ) 1172695.49
Range [ ( max - min ) / 2 * 100% ] 21.12%
DTPS
NightFae_Koraylon Damage Taken Per Second
Count 1319
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
NightFae_Koraylon Healing Per Second
Count 1319
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
NightFae_Koraylon Healing Per Second (Effective)
Count 1319
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
NightFae_Koraylon Heal
Count 1319
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
NightFae_Koraylon Healing Taken Per Second
Count 1319
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
NightFae_Koraylon Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
NightFae_KoraylonTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
NightFae_Koraylon Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 variable,name=prepull_evo,op=reset,default=0
1 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
2 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
3 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
4 0.00 variable,name=have_opened,op=reset,default=0
5 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
6 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
7 0.00 variable,name=final_burn,op=set,value=0
8 0.00 variable,name=rs_max_delay,op=reset,default=5
9 0.00 variable,name=ap_max_delay,op=reset,default=10
A 0.00 variable,name=rop_max_delay,op=reset,default=20
B 0.00 variable,name=totm_max_delay,op=reset,default=5
C 0.00 variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
D 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
E 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
F 0.00 variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
G 0.00 variable,name=barrage_mana_pct,op=reset,default=70
H 0.00 variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
I 0.00 variable,name=ap_minimum_mana_pct,op=reset,default=30
J 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
K 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
L 0.00 variable,name=totm_max_charges,op=reset,default=2
M 0.00 variable,name=aoe_totm_max_charges,op=reset,default=2
N 0.00 variable,name=am_spam,op=reset,default=0
O 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
P 0.00 variable,name=am_spam_evo_pct,op=reset,default=15
Q 0.00 flask
R 0.00 food
S 0.00 augmentation
T 0.00 arcane_familiar
U 0.00 arcane_intellect
V 0.00 conjure_mana_gem
W 0.00 snapshot_stats
X 0.00 mirror_image
Y 0.00 frostbolt,if=variable.prepull_evo<=0
Z 0.00 evocation,if=variable.prepull_evo>0
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
a 0.00 call_action_list,name=shared_cds
b 0.00 call_action_list,name=essences
c 0.00 call_action_list,name=aoe,if=active_enemies>2
d 0.00 call_action_list,name=opener,if=variable.have_opened<=0
e 0.00 call_action_list,name=am_spam,if=variable.am_spam=1
f 0.00 call_action_list,name=cooldowns
g 0.00 call_action_list,name=rotation,if=variable.final_burn=0
h 0.00 call_action_list,name=final_burn,if=variable.final_burn=1
i 0.00 call_action_list,name=movement
actions.aoe
# count action,conditions
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
0.00 arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
0.00 mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
j 7.05 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
k 3.56 arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
l 6.96 rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
0.00 presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
0.00 arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
0.00 supernova
m 14.20 arcane_orb,if=buff.arcane_charge.stack=0
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
n 6.11 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
o 155.64 arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
0.00 arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
p 58.69 arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
q 0.43 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.shared_cds
# count action,conditions
r 2.84 use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
s 3.56 use_items,if=buff.arcane_power.up
t 1.48 potion,if=buff.arcane_power.up
u 1.99 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
0.00 lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
v 2.00 berserking,if=buff.arcane_power.up
0.00 blood_fury,if=buff.arcane_power.up
0.00 fireblood,if=buff.arcane_power.up
0.00 ancestral_call,if=buff.arcane_power.up

Sample Sequence

045789ABDGHILMNPQRVXYjukstvpmpoooopoooopoooolpoooropoooopmpooonopoooopmpoooopoooopojlpoooopmpoooopoooopnmpoojlpoooopooookspmpoooopoooopooonopjlpmpooooporooopoooopmpoooopooonopjlpmpoooopoooopooooksvpmpoooopoooopnjlpmpoooopoooopoooopmpuoooopoooopooonorpjlpmpoooopoooopooqoopmpooookspoooopootoopmpjlpoooopoooonpmpoooopoooopjlpoo

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 prepull_evo Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat 4 have_opened Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat 5 have_opened Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat 7 final_burn Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat 8 rs_max_delay Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat 9 ap_max_delay Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat A rop_max_delay Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat B totm_max_delay Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat D totm_max_delay Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat G barrage_mana_pct Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat H barrage_mana_pct Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat I ap_minimum_mana_pct Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat L totm_max_charges Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat M aoe_totm_max_charges Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat N am_spam Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat P am_spam_evo_pct Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat Q flask NightFae_Koraylon 67365.7/67366: 100% mana
Pre precombat R food NightFae_Koraylon 67365.7/67366: 100% mana
Pre precombat V conjure_mana_gem Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat X mirror_image Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat Y frostbolt Fluffy_Pillow 67365.7/67366: 100% mana
0:00.000 aoe j touch_of_the_magi Fluffy_Pillow 66365.7/67366: 99% mana
0:01.299 shared_cds u time_warp Fluffy_Pillow 64871.1/67366: 96% mana bloodlust, arcane_charge(4), crimson_chorus
0:01.299 aoe k arcane_power Fluffy_Pillow 62871.1/67366: 93% mana bloodlust, arcane_charge(4), temporal_warp, crimson_chorus
0:01.299 shared_cds s use_items Fluffy_Pillow 62871.1/67366: 93% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, crimson_chorus
0:01.299 shared_cds t potion Fluffy_Pillow 62871.1/67366: 93% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, crimson_chorus, gladiators_badge
0:01.299 shared_cds v berserking Fluffy_Pillow 62871.1/67366: 93% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:01.299 aoe p arcane_barrage Fluffy_Pillow 62871.1/67366: 93% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:02.052 aoe m arcane_orb Fluffy_Pillow 66580.3/67366: 99% mana bloodlust, berserking, arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:02.806 aoe p arcane_barrage Fluffy_Pillow 67346.1/67366: 100% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:03.562 aoe o arcane_explosion Fluffy_Pillow 67365.7/67366: 100% mana bloodlust, berserking, arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:04.317 aoe o arcane_explosion Fluffy_Pillow 65882.9/67366: 98% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:05.073 aoe o arcane_explosion Fluffy_Pillow 64401.5/67366: 96% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:05.826 aoe o arcane_explosion Fluffy_Pillow 62916.0/67366: 93% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:06.580 aoe p arcane_barrage Fluffy_Pillow 61431.9/67366: 91% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:07.335 aoe o arcane_explosion Fluffy_Pillow 65143.8/67366: 97% mana bloodlust, berserking, arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:08.090 aoe o arcane_explosion Fluffy_Pillow 63661.0/67366: 95% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:08.845 aoe o arcane_explosion Fluffy_Pillow 62178.2/67366: 92% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:09.599 aoe o arcane_explosion Fluffy_Pillow 60694.1/67366: 90% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:10.352 aoe p arcane_barrage Fluffy_Pillow 59208.6/67366: 88% mana bloodlust, berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:11.107 aoe o arcane_explosion Fluffy_Pillow 62920.5/67366: 93% mana bloodlust, berserking, arcane_power, clearcasting, rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:11.860 aoe o arcane_explosion Fluffy_Pillow 63935.0/67366: 95% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:12.613 aoe o arcane_explosion Fluffy_Pillow 62449.5/67366: 93% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:13.365 aoe o arcane_explosion Fluffy_Pillow 60962.7/67366: 90% mana bloodlust, arcane_charge(3), arcane_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:14.135 aoe l rune_of_power Fluffy_Pillow 59500.1/67366: 88% mana bloodlust, arcane_charge(4), arcane_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:14.906 aoe p arcane_barrage Fluffy_Pillow 60538.9/67366: 90% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:15.676 aoe o arcane_explosion Fluffy_Pillow 64271.0/67366: 95% mana bloodlust, arcane_power, rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:16.447 aoe o arcane_explosion Fluffy_Pillow 62809.7/67366: 93% mana bloodlust, arcane_charge, rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation
0:17.218 aoe o arcane_explosion Fluffy_Pillow 58848.5/67366: 87% mana bloodlust, arcane_charge(2), rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation
0:17.987 shared_cds r use_mana_gem NightFae_Koraylon 54884.6/67366: 81% mana bloodlust, arcane_charge(3), rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation
0:17.987 aoe o arcane_explosion Fluffy_Pillow 61621.2/67366: 91% mana bloodlust, arcane_charge(3), rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation
0:18.758 aoe p arcane_barrage Fluffy_Pillow 57660.0/67366: 86% mana bloodlust, arcane_charge(4), clearcasting, rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation
0:19.529 aoe o arcane_explosion Fluffy_Pillow 61393.4/67366: 91% mana bloodlust, clearcasting, rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation
0:20.299 aoe o arcane_explosion Fluffy_Pillow 62430.8/67366: 93% mana bloodlust, arcane_charge, rune_of_power, temporal_warp, crimson_chorus(3), potion_of_deathly_fixation
0:21.068 aoe o arcane_explosion Fluffy_Pillow 58466.9/67366: 87% mana bloodlust, arcane_charge(2), clearcasting, rune_of_power, temporal_warp, crimson_chorus(3), potion_of_deathly_fixation
0:21.839 aoe o arcane_explosion Fluffy_Pillow 59505.7/67366: 88% mana bloodlust, arcane_charge(3), rune_of_power, temporal_warp, crimson_chorus(3), potion_of_deathly_fixation
0:22.608 aoe p arcane_barrage Fluffy_Pillow 55541.7/67366: 82% mana bloodlust, arcane_charge(4), rune_of_power, temporal_warp, crimson_chorus(3), potion_of_deathly_fixation
0:23.378 aoe m arcane_orb Fluffy_Pillow 59273.8/67366: 88% mana bloodlust, rune_of_power, temporal_warp, crimson_chorus(3), potion_of_deathly_fixation
0:24.148 aoe p arcane_barrage Fluffy_Pillow 59811.2/67366: 89% mana bloodlust, arcane_charge(4), rune_of_power, temporal_warp, crimson_chorus(3), potion_of_deathly_fixation
0:24.917 aoe o arcane_explosion Fluffy_Pillow 63542.0/67366: 94% mana bloodlust, rune_of_power, temporal_warp, crimson_chorus(3), potion_of_deathly_fixation
0:25.686 aoe o arcane_explosion Fluffy_Pillow 59578.0/67366: 88% mana bloodlust, arcane_charge, rune_of_power, temporal_warp, crimson_chorus(3), potion_of_deathly_fixation
0:26.455 aoe o arcane_explosion Fluffy_Pillow 55614.1/67366: 83% mana bloodlust, arcane_charge(2), rune_of_power, temporal_warp, crimson_chorus(3)
0:27.224 aoe n shifting_power Fluffy_Pillow 51650.2/67366: 77% mana bloodlust, arcane_charge(3), temporal_warp, crimson_chorus(3)
0:29.414 aoe o arcane_explosion Fluffy_Pillow 52100.8/67366: 77% mana bloodlust, arcane_charge(3), temporal_warp, crimson_chorus(3)
0:30.184 aoe p arcane_barrage Fluffy_Pillow 48138.3/67366: 71% mana bloodlust, arcane_charge(4), clearcasting, temporal_warp, crimson_chorus(3)
0:30.954 aoe o arcane_explosion Fluffy_Pillow 51870.3/67366: 77% mana bloodlust, clearcasting, temporal_warp
0:31.725 aoe o arcane_explosion Fluffy_Pillow 52909.1/67366: 79% mana bloodlust, arcane_charge, temporal_warp
0:32.496 aoe o arcane_explosion Fluffy_Pillow 48947.9/67366: 73% mana bloodlust, arcane_charge(2), clearcasting, temporal_warp
0:33.268 aoe o arcane_explosion Fluffy_Pillow 49988.0/67366: 74% mana bloodlust, arcane_charge(3), temporal_warp
0:34.037 aoe p arcane_barrage Fluffy_Pillow 46024.1/67366: 68% mana bloodlust, arcane_charge(4), temporal_warp
0:34.806 aoe m arcane_orb Fluffy_Pillow 49754.8/67366: 74% mana bloodlust, temporal_warp
0:35.576 aoe p arcane_barrage Fluffy_Pillow 50292.2/67366: 75% mana bloodlust, arcane_charge(4), temporal_warp
0:36.348 aoe o arcane_explosion Fluffy_Pillow 54027.0/67366: 80% mana bloodlust, temporal_warp
0:37.119 aoe o arcane_explosion Fluffy_Pillow 50065.8/67366: 74% mana bloodlust, arcane_charge, temporal_warp
0:37.891 aoe o arcane_explosion Fluffy_Pillow 46105.9/67366: 68% mana bloodlust, arcane_charge(2), clearcasting, temporal_warp
0:38.663 aoe o arcane_explosion Fluffy_Pillow 47146.0/67366: 70% mana bloodlust, arcane_charge(3), temporal_warp
0:39.434 aoe p arcane_barrage Fluffy_Pillow 43184.8/67366: 64% mana bloodlust, arcane_charge(4), temporal_warp
0:40.206 aoe o arcane_explosion Fluffy_Pillow 46919.6/67366: 70% mana bloodlust, temporal_warp
0:40.977 aoe o arcane_explosion Fluffy_Pillow 42958.3/67366: 64% mana bloodlust, arcane_charge, clearcasting, temporal_warp
0:41.748 aoe o arcane_explosion Fluffy_Pillow 43997.1/67366: 65% mana arcane_charge(2)
0:43.047 aoe o arcane_explosion Fluffy_Pillow 40747.3/67366: 60% mana arcane_charge(3)
0:44.346 aoe p arcane_barrage Fluffy_Pillow 37497.4/67366: 56% mana arcane_charge(4), clearcasting
0:45.647 aoe o arcane_explosion Fluffy_Pillow 41944.9/67366: 62% mana clearcasting
0:46.947 aoe j touch_of_the_magi Fluffy_Pillow 43696.4/67366: 65% mana arcane_charge
0:48.247 aoe l rune_of_power Fluffy_Pillow 42947.9/67366: 64% mana arcane_charge(4)
0:49.546 aoe p arcane_barrage Fluffy_Pillow 44698.1/67366: 66% mana arcane_charge(4), rune_of_power
0:50.846 aoe o arcane_explosion Fluffy_Pillow 49144.2/67366: 73% mana rune_of_power
0:52.145 aoe o arcane_explosion Fluffy_Pillow 45894.4/67366: 68% mana arcane_charge, rune_of_power
0:53.444 aoe o arcane_explosion Fluffy_Pillow 42644.6/67366: 63% mana arcane_charge(2), rune_of_power
0:54.743 aoe o arcane_explosion Fluffy_Pillow 39394.7/67366: 58% mana arcane_charge(3), rune_of_power
0:56.043 aoe p arcane_barrage Fluffy_Pillow 36146.2/67366: 54% mana arcane_charge(4), rune_of_power
0:57.344 aoe m arcane_orb Fluffy_Pillow 40593.7/67366: 60% mana rune_of_power
0:58.646 aoe p arcane_barrage Fluffy_Pillow 41847.9/67366: 62% mana arcane_charge(4), rune_of_power
0:59.946 aoe o arcane_explosion Fluffy_Pillow 46294.1/67366: 69% mana rune_of_power
1:01.245 aoe o arcane_explosion Fluffy_Pillow 43044.2/67366: 64% mana arcane_charge, rune_of_power
1:02.544 aoe o arcane_explosion Fluffy_Pillow 39794.4/67366: 59% mana arcane_charge(2), crimson_chorus
1:03.844 aoe o arcane_explosion Fluffy_Pillow 36545.9/67366: 54% mana arcane_charge(3), crimson_chorus
1:05.141 aoe p arcane_barrage Fluffy_Pillow 33293.4/67366: 49% mana arcane_charge(4), crimson_chorus
1:06.440 aoe o arcane_explosion Fluffy_Pillow 37738.1/67366: 56% mana crimson_chorus
1:07.738 aoe o arcane_explosion Fluffy_Pillow 34487.0/67366: 51% mana arcane_charge, crimson_chorus
1:09.037 aoe o arcane_explosion Fluffy_Pillow 31237.1/67366: 46% mana arcane_charge(2), crimson_chorus
1:10.337 aoe o arcane_explosion Fluffy_Pillow 27988.6/67366: 42% mana arcane_charge(3), crimson_chorus
1:11.636 aoe p arcane_barrage Fluffy_Pillow 24738.8/67366: 37% mana arcane_charge(4), crimson_chorus(2)
1:12.935 aoe n shifting_power Fluffy_Pillow 29183.6/67366: 43% mana crimson_chorus(2)
1:16.601 aoe m arcane_orb Fluffy_Pillow 31622.8/67366: 47% mana crimson_chorus(2)
1:17.901 aoe p arcane_barrage Fluffy_Pillow 32874.3/67366: 49% mana arcane_charge(4), crimson_chorus(2)
1:19.201 aoe o arcane_explosion Fluffy_Pillow 37320.5/67366: 55% mana crimson_chorus(2)
1:20.501 aoe o arcane_explosion Fluffy_Pillow 34072.0/67366: 51% mana arcane_charge, crimson_chorus(2)
1:21.801 aoe j touch_of_the_magi Fluffy_Pillow 30823.5/67366: 46% mana arcane_charge(2), crimson_chorus(3)
1:23.102 aoe l rune_of_power Fluffy_Pillow 30076.3/67366: 45% mana arcane_charge(4), crimson_chorus(3)
1:24.402 aoe p arcane_barrage Fluffy_Pillow 31827.9/67366: 47% mana arcane_charge(4), rune_of_power, crimson_chorus(3)
1:25.702 aoe o arcane_explosion Fluffy_Pillow 36274.0/67366: 54% mana rune_of_power, crimson_chorus(3)
1:27.002 aoe o arcane_explosion Fluffy_Pillow 33025.5/67366: 49% mana arcane_charge, rune_of_power, crimson_chorus(3)
1:28.301 aoe o arcane_explosion Fluffy_Pillow 29775.7/67366: 44% mana arcane_charge(2), rune_of_power, crimson_chorus(3)
1:29.600 aoe o arcane_explosion Fluffy_Pillow 26525.8/67366: 39% mana arcane_charge(3), clearcasting, rune_of_power, crimson_chorus(3)
1:30.902 aoe p arcane_barrage Fluffy_Pillow 28280.0/67366: 42% mana arcane_charge(4), rune_of_power, crimson_chorus(3)
1:32.199 aoe o arcane_explosion Fluffy_Pillow 32722.1/67366: 49% mana rune_of_power
1:33.500 aoe o arcane_explosion Fluffy_Pillow 29475.0/67366: 44% mana arcane_charge, rune_of_power
1:34.800 aoe o arcane_explosion Fluffy_Pillow 26226.5/67366: 39% mana arcane_charge(2), rune_of_power
1:36.099 aoe o arcane_explosion Fluffy_Pillow 22976.7/67366: 34% mana arcane_charge(3), rune_of_power
1:37.399 aoe k arcane_power Fluffy_Pillow 19728.2/67366: 29% mana arcane_charge(4)
1:37.399 shared_cds s use_items Fluffy_Pillow 19728.2/67366: 29% mana arcane_charge(4), arcane_power, rune_of_power
1:37.399 aoe p arcane_barrage Fluffy_Pillow 19728.2/67366: 29% mana arcane_charge(4), arcane_power, rune_of_power, gladiators_badge
1:38.697 aoe m arcane_orb Fluffy_Pillow 24171.6/67366: 36% mana arcane_power, rune_of_power, gladiators_badge
1:39.996 aoe p arcane_barrage Fluffy_Pillow 25671.8/67366: 38% mana arcane_charge(4), arcane_power, rune_of_power, gladiators_badge
1:41.297 aoe o arcane_explosion Fluffy_Pillow 30119.2/67366: 45% mana arcane_power, rune_of_power, gladiators_badge
1:42.597 aoe o arcane_explosion Fluffy_Pillow 29370.8/67366: 44% mana arcane_charge, arcane_power, rune_of_power, gladiators_badge
1:43.897 aoe o arcane_explosion Fluffy_Pillow 28622.3/67366: 42% mana arcane_charge(2), arcane_power, rune_of_power, gladiators_badge
1:45.197 aoe o arcane_explosion Fluffy_Pillow 27873.8/67366: 41% mana arcane_charge(3), arcane_power, rune_of_power, gladiators_badge
1:46.497 aoe p arcane_barrage Fluffy_Pillow 27125.3/67366: 40% mana arcane_charge(4), arcane_power, rune_of_power, gladiators_badge
1:47.797 aoe o arcane_explosion Fluffy_Pillow 31571.4/67366: 47% mana arcane_power, rune_of_power, gladiators_badge
1:49.097 aoe o arcane_explosion Fluffy_Pillow 30822.9/67366: 46% mana arcane_charge, arcane_power, clearcasting, rune_of_power, gladiators_badge
1:50.399 aoe o arcane_explosion Fluffy_Pillow 32577.1/67366: 48% mana arcane_charge(2), arcane_power, gladiators_badge
1:51.696 aoe o arcane_explosion Fluffy_Pillow 31824.6/67366: 47% mana arcane_charge(3), arcane_power, gladiators_badge
1:52.996 aoe p arcane_barrage Fluffy_Pillow 31076.1/67366: 46% mana arcane_charge(4)
1:54.296 aoe o arcane_explosion Fluffy_Pillow 35522.2/67366: 53% mana
1:55.597 aoe o arcane_explosion Fluffy_Pillow 32275.1/67366: 48% mana arcane_charge
1:56.896 aoe o arcane_explosion Fluffy_Pillow 29025.3/67366: 43% mana arcane_charge(2), clearcasting
1:58.195 aoe n shifting_power Fluffy_Pillow 30775.4/67366: 46% mana arcane_charge(3)
2:01.939 aoe o arcane_explosion Fluffy_Pillow 33319.8/67366: 49% mana arcane_charge(3), crimson_chorus
2:03.239 aoe p arcane_barrage Fluffy_Pillow 30071.3/67366: 45% mana arcane_charge(4), crimson_chorus
2:04.539 aoe j touch_of_the_magi Fluffy_Pillow 34517.4/67366: 51% mana crimson_chorus
2:05.838 aoe l rune_of_power Fluffy_Pillow 33767.6/67366: 50% mana arcane_charge(4), crimson_chorus
2:07.137 aoe p arcane_barrage Fluffy_Pillow 35517.7/67366: 53% mana arcane_charge(4), rune_of_power, crimson_chorus
2:08.436 aoe m arcane_orb Fluffy_Pillow 39962.5/67366: 59% mana rune_of_power, crimson_chorus
2:09.735 aoe p arcane_barrage Fluffy_Pillow 41212.7/67366: 61% mana arcane_charge(4), rune_of_power, crimson_chorus
2:11.033 aoe o arcane_explosion Fluffy_Pillow 45656.1/67366: 68% mana rune_of_power, crimson_chorus
2:12.332 aoe o arcane_explosion Fluffy_Pillow 42406.3/67366: 63% mana arcane_charge, rune_of_power, crimson_chorus(2)
2:13.631 aoe o arcane_explosion Fluffy_Pillow 39156.5/67366: 58% mana arcane_charge(2), rune_of_power, crimson_chorus(2)
2:14.933 aoe o arcane_explosion Fluffy_Pillow 35910.7/67366: 53% mana arcane_charge(3), rune_of_power, crimson_chorus(2)
2:16.235 aoe p arcane_barrage Fluffy_Pillow 32664.9/67366: 48% mana arcane_charge(4), rune_of_power, crimson_chorus(2)
2:17.535 aoe o arcane_explosion Fluffy_Pillow 37111.0/67366: 55% mana rune_of_power, crimson_chorus(2)
2:18.835 shared_cds r use_mana_gem NightFae_Koraylon 33862.5/67366: 50% mana arcane_charge, rune_of_power, crimson_chorus(2)
2:18.835 aoe o arcane_explosion Fluffy_Pillow 40599.1/67366: 60% mana arcane_charge, rune_of_power, crimson_chorus(2)
2:20.135 aoe o arcane_explosion Fluffy_Pillow 37350.6/67366: 55% mana arcane_charge(2), crimson_chorus(2)
2:21.434 aoe o arcane_explosion Fluffy_Pillow 34100.7/67366: 51% mana arcane_charge(3), crimson_chorus(2)
2:22.735 aoe p arcane_barrage Fluffy_Pillow 30853.6/67366: 46% mana arcane_charge(4), clearcasting, crimson_chorus(3)
2:24.034 aoe o arcane_explosion Fluffy_Pillow 35298.4/67366: 52% mana clearcasting, crimson_chorus(3)
2:25.334 aoe o arcane_explosion Fluffy_Pillow 37049.9/67366: 55% mana arcane_charge, crimson_chorus(3)
2:26.634 aoe o arcane_explosion Fluffy_Pillow 33801.4/67366: 50% mana arcane_charge(2), crimson_chorus(3)
2:27.933 aoe o arcane_explosion Fluffy_Pillow 30551.6/67366: 45% mana arcane_charge(3), crimson_chorus(3)
2:29.233 aoe p arcane_barrage Fluffy_Pillow 27303.1/67366: 41% mana arcane_charge(4), crimson_chorus(3)
2:30.531 aoe m arcane_orb Fluffy_Pillow 31746.5/67366: 47% mana crimson_chorus(3)
2:31.831 aoe p arcane_barrage Fluffy_Pillow 32998.0/67366: 49% mana arcane_charge(4)
2:33.130 aoe o arcane_explosion Fluffy_Pillow 37442.8/67366: 56% mana
2:34.429 aoe o arcane_explosion Fluffy_Pillow 34193.0/67366: 51% mana arcane_charge
2:35.728 aoe o arcane_explosion Fluffy_Pillow 30943.1/67366: 46% mana arcane_charge(2)
2:37.027 aoe o arcane_explosion Fluffy_Pillow 27693.3/67366: 41% mana arcane_charge(3)
2:38.328 aoe p arcane_barrage Fluffy_Pillow 24446.2/67366: 36% mana arcane_charge(4), clearcasting
2:39.629 aoe o arcane_explosion Fluffy_Pillow 28893.6/67366: 43% mana clearcasting
2:40.928 aoe o arcane_explosion Fluffy_Pillow 30643.8/67366: 45% mana arcane_charge
2:42.228 aoe o arcane_explosion Fluffy_Pillow 27395.3/67366: 41% mana arcane_charge(2)
2:43.528 aoe n shifting_power Fluffy_Pillow 24146.8/67366: 36% mana arcane_charge(3)
2:47.252 aoe o arcane_explosion Fluffy_Pillow 26664.2/67366: 40% mana arcane_charge(3)
2:48.552 aoe p arcane_barrage Fluffy_Pillow 23415.7/67366: 35% mana arcane_charge(4)
2:49.851 aoe j touch_of_the_magi Fluffy_Pillow 27860.5/67366: 41% mana
2:51.150 aoe l rune_of_power Fluffy_Pillow 27110.7/67366: 40% mana arcane_charge(4)
2:52.450 aoe p arcane_barrage Fluffy_Pillow 28862.2/67366: 43% mana arcane_charge(4), rune_of_power
2:53.750 aoe m arcane_orb Fluffy_Pillow 33308.3/67366: 49% mana rune_of_power
2:55.051 aoe p arcane_barrage Fluffy_Pillow 34561.2/67366: 51% mana arcane_charge(4), rune_of_power
2:56.351 aoe o arcane_explosion Fluffy_Pillow 39007.3/67366: 58% mana rune_of_power
2:57.650 aoe o arcane_explosion Fluffy_Pillow 35757.5/67366: 53% mana arcane_charge, rune_of_power
2:58.952 aoe o arcane_explosion Fluffy_Pillow 32511.7/67366: 48% mana arcane_charge(2), rune_of_power
3:00.251 aoe o arcane_explosion Fluffy_Pillow 29261.8/67366: 43% mana arcane_charge(3), rune_of_power
3:01.554 aoe p arcane_barrage Fluffy_Pillow 26017.4/67366: 39% mana arcane_charge(4), rune_of_power
3:02.855 aoe o arcane_explosion Fluffy_Pillow 30464.9/67366: 45% mana rune_of_power, crimson_chorus
3:04.154 aoe o arcane_explosion Fluffy_Pillow 27215.0/67366: 40% mana arcane_charge, rune_of_power, crimson_chorus
3:05.453 aoe o arcane_explosion Fluffy_Pillow 23965.2/67366: 36% mana arcane_charge(2), crimson_chorus
3:06.751 aoe o arcane_explosion Fluffy_Pillow 20714.0/67366: 31% mana arcane_charge(3), crimson_chorus
3:08.050 aoe p arcane_barrage Fluffy_Pillow 17464.2/67366: 26% mana arcane_charge(4), crimson_chorus
3:09.348 aoe o arcane_explosion Fluffy_Pillow 21907.6/67366: 33% mana crimson_chorus
3:10.649 aoe o arcane_explosion Fluffy_Pillow 18660.5/67366: 28% mana arcane_charge, clearcasting, crimson_chorus
3:11.950 aoe o arcane_explosion Fluffy_Pillow 20413.3/67366: 30% mana arcane_charge(2), crimson_chorus
3:13.251 aoe o arcane_explosion Fluffy_Pillow 17166.2/67366: 25% mana arcane_charge(3), crimson_chorus(2)
3:14.553 aoe k arcane_power Fluffy_Pillow 13920.4/67366: 21% mana arcane_charge(4), crimson_chorus(2)
3:14.553 shared_cds s use_items Fluffy_Pillow 13920.4/67366: 21% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2)
3:14.553 shared_cds v berserking Fluffy_Pillow 13920.4/67366: 21% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
3:14.553 aoe p arcane_barrage Fluffy_Pillow 13920.4/67366: 21% mana berserking, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
3:15.734 aoe m arcane_orb Fluffy_Pillow 18206.2/67366: 27% mana berserking, arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
3:16.916 aoe p arcane_barrage Fluffy_Pillow 19548.7/67366: 29% mana berserking, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
3:18.099 aoe o arcane_explosion Fluffy_Pillow 23837.2/67366: 35% mana berserking, arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
3:19.283 aoe o arcane_explosion Fluffy_Pillow 22932.4/67366: 34% mana berserking, arcane_charge, arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
3:20.466 aoe o arcane_explosion Fluffy_Pillow 22026.3/67366: 33% mana berserking, arcane_charge(2), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
3:21.648 aoe o arcane_explosion Fluffy_Pillow 21118.8/67366: 31% mana berserking, arcane_charge(3), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
3:22.833 aoe p arcane_barrage Fluffy_Pillow 20215.4/67366: 30% mana berserking, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
3:24.014 aoe o arcane_explosion Fluffy_Pillow 24501.2/67366: 36% mana berserking, arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
3:25.197 aoe o arcane_explosion Fluffy_Pillow 23595.1/67366: 35% mana berserking, arcane_charge, arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
3:26.381 aoe o arcane_explosion Fluffy_Pillow 22690.3/67366: 34% mana berserking, arcane_charge(2), arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
3:27.563 aoe o arcane_explosion Fluffy_Pillow 21782.8/67366: 32% mana arcane_charge(3), arcane_power, crimson_chorus(3), gladiators_badge
3:28.863 aoe p arcane_barrage Fluffy_Pillow 21034.3/67366: 31% mana arcane_charge(4), arcane_power, crimson_chorus(3), gladiators_badge
3:30.163 aoe n shifting_power Fluffy_Pillow 25480.5/67366: 38% mana crimson_chorus(3)
3:33.752 aoe j touch_of_the_magi Fluffy_Pillow 27816.0/67366: 41% mana
3:35.050 aoe l rune_of_power Fluffy_Pillow 27064.8/67366: 40% mana arcane_charge(4)
3:36.351 aoe p arcane_barrage Fluffy_Pillow 28817.7/67366: 43% mana arcane_charge(4), rune_of_power
3:37.652 aoe m arcane_orb Fluffy_Pillow 33265.1/67366: 49% mana rune_of_power
3:38.953 aoe p arcane_barrage Fluffy_Pillow 34518.0/67366: 51% mana arcane_charge(4), rune_of_power
3:40.253 aoe o arcane_explosion Fluffy_Pillow 38964.1/67366: 58% mana rune_of_power
3:41.551 aoe o arcane_explosion Fluffy_Pillow 35713.0/67366: 53% mana arcane_charge, rune_of_power
3:42.851 aoe o arcane_explosion Fluffy_Pillow 32464.5/67366: 48% mana arcane_charge(2), rune_of_power
3:44.150 aoe o arcane_explosion Fluffy_Pillow 29214.6/67366: 43% mana arcane_charge(3), rune_of_power
3:45.449 aoe p arcane_barrage Fluffy_Pillow 25964.8/67366: 39% mana arcane_charge(4), rune_of_power
3:46.749 aoe o arcane_explosion Fluffy_Pillow 30410.9/67366: 45% mana rune_of_power
3:48.049 aoe o arcane_explosion Fluffy_Pillow 27162.4/67366: 40% mana arcane_charge, rune_of_power
3:49.349 aoe o arcane_explosion Fluffy_Pillow 23913.9/67366: 35% mana arcane_charge(2)
3:50.650 aoe o arcane_explosion Fluffy_Pillow 20666.8/67366: 31% mana arcane_charge(3), clearcasting
3:51.950 aoe p arcane_barrage Fluffy_Pillow 22418.3/67366: 33% mana arcane_charge(4)
3:53.249 aoe o arcane_explosion Fluffy_Pillow 26863.1/67366: 40% mana
3:54.549 aoe o arcane_explosion Fluffy_Pillow 23614.6/67366: 35% mana arcane_charge, clearcasting
3:55.850 aoe o arcane_explosion Fluffy_Pillow 25367.5/67366: 38% mana arcane_charge(2)
3:57.149 aoe o arcane_explosion Fluffy_Pillow 22117.6/67366: 33% mana arcane_charge(3)
3:58.448 aoe p arcane_barrage Fluffy_Pillow 18867.8/67366: 28% mana arcane_charge(4)
3:59.748 aoe m arcane_orb Fluffy_Pillow 23313.9/67366: 35% mana
4:01.047 aoe p arcane_barrage Fluffy_Pillow 24564.1/67366: 36% mana arcane_charge(4)
4:02.347 shared_cds u time_warp Fluffy_Pillow 29010.2/67366: 43% mana
4:02.347 aoe o arcane_explosion Fluffy_Pillow 27010.2/67366: 40% mana temporal_warp
4:03.349 aoe o arcane_explosion Fluffy_Pillow 23360.2/67366: 35% mana arcane_charge, temporal_warp, crimson_chorus
4:04.350 aoe o arcane_explosion Fluffy_Pillow 19708.9/67366: 29% mana arcane_charge(2), clearcasting, temporal_warp, crimson_chorus
4:05.351 aoe o arcane_explosion Fluffy_Pillow 21057.5/67366: 31% mana arcane_charge(3), temporal_warp, crimson_chorus
4:06.351 aoe p arcane_barrage Fluffy_Pillow 17404.9/67366: 26% mana arcane_charge(4), temporal_warp, crimson_chorus
4:07.352 aoe o arcane_explosion Fluffy_Pillow 21448.1/67366: 32% mana temporal_warp, crimson_chorus
4:08.353 aoe o arcane_explosion Fluffy_Pillow 17796.8/67366: 26% mana arcane_charge, clearcasting, temporal_warp, crimson_chorus
4:09.354 aoe o arcane_explosion Fluffy_Pillow 19145.5/67366: 28% mana arcane_charge(2), temporal_warp, crimson_chorus
4:10.354 aoe o arcane_explosion Fluffy_Pillow 15492.8/67366: 23% mana arcane_charge(3), temporal_warp, crimson_chorus
4:11.355 aoe p arcane_barrage Fluffy_Pillow 11841.4/67366: 18% mana arcane_charge(4), temporal_warp, crimson_chorus
4:12.355 aoe o arcane_explosion Fluffy_Pillow 15883.4/67366: 24% mana temporal_warp, crimson_chorus(2)
4:13.355 aoe o arcane_explosion Fluffy_Pillow 12230.7/67366: 18% mana arcane_charge, temporal_warp, crimson_chorus(2)
4:14.357 aoe o arcane_explosion Fluffy_Pillow 8580.7/67366: 13% mana arcane_charge(2), temporal_warp, crimson_chorus(2)
4:15.357 aoe n shifting_power Fluffy_Pillow 4928.0/67366: 7% mana arcane_charge(3), temporal_warp, crimson_chorus(2)
4:18.254 aoe o arcane_explosion Fluffy_Pillow 6331.2/67366: 9% mana arcane_charge(3), temporal_warp, crimson_chorus(2)
4:19.254 shared_cds r use_mana_gem NightFae_Koraylon 2678.5/67366: 4% mana arcane_charge(4), clearcasting, temporal_warp, crimson_chorus(2)
4:19.254 aoe p arcane_barrage Fluffy_Pillow 9415.1/67366: 14% mana arcane_charge(4), clearcasting, temporal_warp, crimson_chorus(2)
4:20.255 aoe j touch_of_the_magi Fluffy_Pillow 13458.4/67366: 20% mana clearcasting, temporal_warp, crimson_chorus(2)
4:21.255 aoe l rune_of_power Fluffy_Pillow 12305.7/67366: 18% mana arcane_charge(4), clearcasting, temporal_warp, crimson_chorus(2)
4:22.257 aoe p arcane_barrage Fluffy_Pillow 13655.7/67366: 20% mana arcane_charge(4), clearcasting, rune_of_power, temporal_warp, crimson_chorus(2)
4:23.256 aoe m arcane_orb Fluffy_Pillow 17696.3/67366: 26% mana clearcasting, rune_of_power, temporal_warp, crimson_chorus(3)
4:24.257 aoe p arcane_barrage Fluffy_Pillow 18545.0/67366: 28% mana arcane_charge(4), clearcasting, rune_of_power, temporal_warp, crimson_chorus(3)
4:25.260 aoe o arcane_explosion Fluffy_Pillow 22590.9/67366: 34% mana clearcasting, rune_of_power, temporal_warp, crimson_chorus(3)
4:26.260 aoe o arcane_explosion Fluffy_Pillow 23938.3/67366: 36% mana arcane_charge, rune_of_power, temporal_warp, crimson_chorus(3)
4:27.260 aoe o arcane_explosion Fluffy_Pillow 20285.6/67366: 30% mana arcane_charge(2), rune_of_power, temporal_warp, crimson_chorus(3)
4:28.261 aoe o arcane_explosion Fluffy_Pillow 16634.2/67366: 25% mana arcane_charge(3), rune_of_power, temporal_warp, crimson_chorus(3)
4:29.262 aoe p arcane_barrage Fluffy_Pillow 12982.9/67366: 19% mana arcane_charge(4), clearcasting, rune_of_power, temporal_warp, crimson_chorus(3)
4:30.263 aoe o arcane_explosion Fluffy_Pillow 17026.2/67366: 25% mana clearcasting, rune_of_power, temporal_warp, crimson_chorus(3)
4:31.265 aoe o arcane_explosion Fluffy_Pillow 18376.2/67366: 27% mana arcane_charge, rune_of_power, temporal_warp, crimson_chorus(3)
4:32.267 aoe o arcane_explosion Fluffy_Pillow 14726.2/67366: 22% mana arcane_charge(2), rune_of_power, temporal_warp, crimson_chorus(3)
4:33.267 aoe o arcane_explosion Fluffy_Pillow 11073.5/67366: 16% mana arcane_charge(3), rune_of_power, temporal_warp
4:34.268 aoe p arcane_barrage Fluffy_Pillow 7422.2/67366: 11% mana arcane_charge(4), temporal_warp
4:35.268 aoe o arcane_explosion Fluffy_Pillow 11464.1/67366: 17% mana temporal_warp
4:36.269 aoe o arcane_explosion Fluffy_Pillow 7812.8/67366: 12% mana arcane_charge, temporal_warp
4:37.271 aoe q evocation NightFae_Koraylon 4162.8/67366: 6% mana arcane_charge(2), temporal_warp
4:40.596 aoe o arcane_explosion Fluffy_Pillow 61385.7/67366: 91% mana arcane_charge(2), temporal_warp
4:41.597 aoe o arcane_explosion Fluffy_Pillow 57734.3/67366: 86% mana arcane_charge(3), temporal_warp
4:42.597 aoe p arcane_barrage Fluffy_Pillow 54081.7/67366: 80% mana arcane_charge(4)
4:43.896 aoe m arcane_orb Fluffy_Pillow 58526.4/67366: 87% mana
4:45.196 aoe p arcane_barrage Fluffy_Pillow 59778.0/67366: 89% mana arcane_charge(4)
4:46.496 aoe o arcane_explosion Fluffy_Pillow 64224.1/67366: 95% mana
4:47.795 aoe o arcane_explosion Fluffy_Pillow 60974.3/67366: 91% mana arcane_charge
4:49.097 aoe o arcane_explosion Fluffy_Pillow 57728.5/67366: 86% mana arcane_charge(2)
4:50.396 aoe o arcane_explosion Fluffy_Pillow 54478.6/67366: 81% mana arcane_charge(3)
4:51.696 aoe k arcane_power Fluffy_Pillow 51230.1/67366: 76% mana arcane_charge(4), clearcasting
4:51.696 shared_cds s use_items Fluffy_Pillow 51230.1/67366: 76% mana arcane_charge(4), arcane_power, clearcasting, rune_of_power
4:51.696 aoe p arcane_barrage Fluffy_Pillow 51230.1/67366: 76% mana arcane_charge(4), arcane_power, clearcasting, rune_of_power, gladiators_badge
4:52.995 aoe o arcane_explosion Fluffy_Pillow 55674.9/67366: 83% mana arcane_power, clearcasting, rune_of_power, gladiators_badge
4:54.295 aoe o arcane_explosion Fluffy_Pillow 57426.4/67366: 85% mana arcane_charge, arcane_power, rune_of_power, gladiators_badge
4:55.594 aoe o arcane_explosion Fluffy_Pillow 56676.6/67366: 84% mana arcane_charge(2), arcane_power, rune_of_power, gladiators_badge
4:56.896 aoe o arcane_explosion Fluffy_Pillow 55930.8/67366: 83% mana arcane_charge(3), arcane_power, rune_of_power, gladiators_badge
4:58.195 aoe p arcane_barrage Fluffy_Pillow 55181.0/67366: 82% mana arcane_charge(4), arcane_power, rune_of_power, gladiators_badge
4:59.493 aoe o arcane_explosion Fluffy_Pillow 59624.4/67366: 89% mana arcane_power, rune_of_power, gladiators_badge
5:00.794 aoe o arcane_explosion Fluffy_Pillow 58877.3/67366: 87% mana arcane_charge, arcane_power, clearcasting, rune_of_power, gladiators_badge
5:02.095 shared_cds t potion Fluffy_Pillow 60630.1/67366: 90% mana arcane_charge(2), arcane_power, rune_of_power, gladiators_badge
5:02.095 aoe o arcane_explosion Fluffy_Pillow 60630.1/67366: 90% mana arcane_charge(2), arcane_power, rune_of_power, potion_of_deathly_fixation, gladiators_badge
5:03.393 aoe o arcane_explosion Fluffy_Pillow 59878.9/67366: 89% mana arcane_charge(3), arcane_power, rune_of_power, potion_of_deathly_fixation, gladiators_badge
5:04.692 aoe p arcane_barrage Fluffy_Pillow 59129.1/67366: 88% mana arcane_charge(4), arcane_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
5:05.991 aoe m arcane_orb Fluffy_Pillow 63573.9/67366: 94% mana arcane_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
5:07.289 aoe p arcane_barrage Fluffy_Pillow 65072.7/67366: 97% mana arcane_charge(4), crimson_chorus, potion_of_deathly_fixation
5:08.589 aoe j touch_of_the_magi Fluffy_Pillow 67365.7/67366: 100% mana crimson_chorus, potion_of_deathly_fixation
5:09.889 aoe l rune_of_power Fluffy_Pillow 64872.5/67366: 96% mana arcane_charge(4), crimson_chorus, potion_of_deathly_fixation
5:11.188 aoe p arcane_barrage Fluffy_Pillow 66622.6/67366: 99% mana arcane_charge(4), rune_of_power, crimson_chorus, potion_of_deathly_fixation
5:12.487 aoe o arcane_explosion Fluffy_Pillow 67365.7/67366: 100% mana rune_of_power, crimson_chorus, potion_of_deathly_fixation
5:13.786 aoe o arcane_explosion Fluffy_Pillow 64115.9/67366: 95% mana arcane_charge, rune_of_power, crimson_chorus(2), potion_of_deathly_fixation
5:15.086 aoe o arcane_explosion Fluffy_Pillow 60867.4/67366: 90% mana arcane_charge(2), rune_of_power, crimson_chorus(2), potion_of_deathly_fixation
5:16.385 aoe o arcane_explosion Fluffy_Pillow 57617.5/67366: 86% mana arcane_charge(3), rune_of_power, crimson_chorus(2), potion_of_deathly_fixation
5:17.686 aoe p arcane_barrage Fluffy_Pillow 54370.4/67366: 81% mana arcane_charge(4), rune_of_power, crimson_chorus(2), potion_of_deathly_fixation
5:18.986 aoe o arcane_explosion Fluffy_Pillow 58816.5/67366: 87% mana rune_of_power, crimson_chorus(2), potion_of_deathly_fixation
5:20.288 aoe o arcane_explosion Fluffy_Pillow 55570.7/67366: 82% mana arcane_charge, rune_of_power, crimson_chorus(2), potion_of_deathly_fixation
5:21.588 aoe o arcane_explosion Fluffy_Pillow 52322.3/67366: 78% mana arcane_charge(2), clearcasting, rune_of_power, crimson_chorus(2), potion_of_deathly_fixation
5:22.886 aoe o arcane_explosion Fluffy_Pillow 54071.1/67366: 80% mana arcane_charge(3), rune_of_power, crimson_chorus(2), potion_of_deathly_fixation
5:24.186 aoe n shifting_power Fluffy_Pillow 50822.6/67366: 75% mana arcane_charge(4), clearcasting, crimson_chorus(3), potion_of_deathly_fixation
5:27.900 aoe p arcane_barrage Fluffy_Pillow 53326.5/67366: 79% mana arcane_charge(4), clearcasting, crimson_chorus(3)
5:29.200 aoe m arcane_orb Fluffy_Pillow 57772.6/67366: 86% mana clearcasting, crimson_chorus(3)
5:30.499 aoe p arcane_barrage Fluffy_Pillow 59022.8/67366: 88% mana arcane_charge(4), clearcasting, crimson_chorus(3)
5:31.797 aoe o arcane_explosion Fluffy_Pillow 63466.2/67366: 94% mana clearcasting, crimson_chorus(3)
5:33.096 aoe o arcane_explosion Fluffy_Pillow 65216.4/67366: 97% mana arcane_charge, crimson_chorus(3)
5:34.395 aoe o arcane_explosion Fluffy_Pillow 61966.6/67366: 92% mana arcane_charge(2), clearcasting
5:35.694 aoe o arcane_explosion Fluffy_Pillow 63716.7/67366: 95% mana arcane_charge(3)
5:36.993 aoe p arcane_barrage Fluffy_Pillow 60466.9/67366: 90% mana arcane_charge(4)
5:38.291 aoe o arcane_explosion Fluffy_Pillow 64910.3/67366: 96% mana
5:39.591 aoe o arcane_explosion Fluffy_Pillow 61661.8/67366: 92% mana arcane_charge, clearcasting
5:40.890 aoe o arcane_explosion Fluffy_Pillow 63412.0/67366: 94% mana arcane_charge(2)
5:42.188 aoe o arcane_explosion Fluffy_Pillow 60160.8/67366: 89% mana arcane_charge(3)
5:43.488 aoe p arcane_barrage Fluffy_Pillow 56912.3/67366: 84% mana arcane_charge(4)
5:44.788 aoe j touch_of_the_magi Fluffy_Pillow 61358.5/67366: 91% mana
5:46.087 aoe l rune_of_power Fluffy_Pillow 60608.6/67366: 90% mana arcane_charge(4)
5:47.388 aoe p arcane_barrage Fluffy_Pillow 62361.5/67366: 93% mana arcane_charge(4), rune_of_power
5:48.688 aoe o arcane_explosion Fluffy_Pillow 66807.6/67366: 99% mana rune_of_power
5:49.987 aoe o arcane_explosion Fluffy_Pillow 63557.8/67366: 94% mana arcane_charge, rune_of_power

Stats

Level Bonus (60) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 198 1 199 199 0
Agility 306 2 308 308 0
Stamina 414 0 2013 1918 1504
Intellect 450 -3 1767 1588 1066 (46)
Spirit 0 0 0 0 0
Health 40260 38360 0
Mana 67366 67366 0
Spell Power 1767 1588 0
Crit 15.74% 15.74% 376
Haste 15.76% 15.76% 520
Versatility 7.97% 7.97% 319
Mana Regen 1347 1347 0
Mastery 34.73% 34.73% 733
Armor 369 369 369
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 227.00
Local Head Confidant's Favored Cap
ilevel: 226, stats: { 44 Armor, +82 Int, +149 Sta, +44 Haste, +98 Mastery }
Local Neck Noble's Birthstone Pendant
ilevel: 226, stats: { +84 Sta, +52 Crit, +162 Mastery }
Local Shoulders Shawl of the Penitent
ilevel: 233, stats: { 42 Armor, +65 Int, +122 Sta, +33 Crit, +76 Haste }
Local Chest Robes of the Cursed Commando
ilevel: 233, stats: { 61 Armor, +87 Int, +162 Sta, +47 Crit, +100 Haste }, enchant: { +20 Int }
Local Waist Cinch of Infinite Tightness
ilevel: 226, stats: { 33 Armor, +61 Int, +112 Sta, +69 Crit, +36 Vers }
Local Legs Courtier's Costume Trousers
ilevel: 226, stats: { 51 Armor, +82 Int, +149 Sta, +49 Vers, +93 Mastery }
Local Feet Slippers of the Forgotten Heretic
ilevel: 226, stats: { 36 Armor, +61 Int, +112 Sta, +73 Crit, +32 Mastery }
Local Wrists Acolyte's Velvet Bindings
ilevel: 226, stats: { 29 Armor, +46 Int, +84 Sta, +26 Vers, +53 Mastery }, enchant: { +15 Int }
Local Hands Impossibly Oversized Mitts
ilevel: 226, stats: { 33 Armor, +61 Int, +112 Sta, +31 Haste, +74 Mastery }
Local Finger1 Most Regal Signet of Sire Denathrius
ilevel: 233, stats: { +91 Sta, +178 Haste, +48 Mastery }, enchant: { +16 Mastery }
item effects: { equip: Denathrius' Privilege }
Local Finger2 Shadowghast Ring
ilevel: 235, stats: { +94 Sta, +115 Mastery, +115 Vers }, enchant: { +16 Mastery }
item effects: { equip: Temporal Warp }
Local Trinket1 Cabalist's Hymnal
ilevel: 226, stats: { +77 Int }
item effects: { equip: Crimson Chorus }
Local Trinket2 Sinful Aspirant's Badge of Ferocity
ilevel: 207, stats: { +91 Haste }
item effects: { use: Gladiator's Badge }
Local Back Mantle of Manifest Sins
ilevel: 226, stats: { 40 Armor, +84 Sta, +53 Crit, +26 Mastery, +46 StrAgiInt }
Local Main Hand Staff of the Penitent
ilevel: 226, weapon: { 93 - 128, 3.6 }, stats: { +82 Int, +281 Int, +149 Sta, +49 Crit, +93 Vers }, enchant: sinful_revelation

Profile

mage="NightFae_Koraylon"
source=default
spec=arcane
level=60
race=troll
role=spell
position=back
talents=1031021
talent_override=resonance,if=3>2
covenant=night_fae
soulbind=325066//51:6

# Default consumables
potion=deathly_fixation
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=variable,name=prepull_evo,op=reset,default=0
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
actions.precombat+=/variable,name=have_opened,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
actions.precombat+=/variable,name=final_burn,op=set,value=0
actions.precombat+=/variable,name=rs_max_delay,op=reset,default=5
actions.precombat+=/variable,name=ap_max_delay,op=reset,default=10
actions.precombat+=/variable,name=rop_max_delay,op=reset,default=20
actions.precombat+=/variable,name=totm_max_delay,op=reset,default=5
actions.precombat+=/variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
actions.precombat+=/variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
actions.precombat+=/variable,name=barrage_mana_pct,op=reset,default=70
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=reset,default=30
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
actions.precombat+=/variable,name=totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=aoe_totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=am_spam,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
actions.precombat+=/variable,name=am_spam_evo_pct,op=reset,default=15
actions.precombat+=/flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_familiar
actions.precombat+=/arcane_intellect
actions.precombat+=/conjure_mana_gem
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/frostbolt,if=variable.prepull_evo<=0
actions.precombat+=/evocation,if=variable.prepull_evo>0

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/call_action_list,name=shared_cds
actions+=/call_action_list,name=essences
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/call_action_list,name=opener,if=variable.have_opened<=0
actions+=/call_action_list,name=am_spam,if=variable.am_spam=1
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=rotation,if=variable.final_burn=0
actions+=/call_action_list,name=final_burn,if=variable.final_burn=1
actions+=/call_action_list,name=movement

actions.am_spam=cancel_action,if=action.evocation.channeling&mana.pct>=95
actions.am_spam+=/evocation,if=mana.pct<=variable.am_spam_evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/rune_of_power,if=buff.rune_of_power.down&cooldown.arcane_power.remains>0
actions.am_spam+=/touch_of_the_magi,if=(cooldown.arcane_power.remains=0&buff.rune_of_power.down)|prev_gcd.1.rune_of_power
actions.am_spam+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&buff.rune_of_power.down&essence.vision_of_perfection.enabled
actions.am_spam+=/arcane_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.ap_max_delay
actions.am_spam+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=action.arcane_missiles.execute_time&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_barrage,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_missiles,if=buff.clearcasting.react,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/arcane_missiles,if=!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.am_spam+=/arcane_barrage
actions.am_spam+=/arcane_blast

actions.aoe=frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
actions.aoe+=/arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
actions.aoe+=/mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
actions.aoe+=/arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
actions.aoe+=/rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
actions.aoe+=/presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
actions.aoe+=/arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
actions.aoe+=/supernova
actions.aoe+=/arcane_orb,if=buff.arcane_charge.stack=0
actions.aoe+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
actions.aoe+=/arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1

# Prioritize using grisly icicle with ap. Use it with totm otherwise.
actions.cooldowns=frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.cooldowns+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
# Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
# Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
actions.cooldowns+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
# Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
# Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
# Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
actions.cooldowns+=/arcane_power,if=(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
actions.cooldowns+=/rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
# Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
actions.cooldowns+=/presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
# Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.cooldowns+=/presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled

actions.essences=blood_of_the_enemy,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/blood_of_the_enemy,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains>=50&cooldown.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay
actions.essences+=/worldvein_resonance,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/guardian_of_azeroth,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/guardian_of_azeroth,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/concentrated_flame,line_cd=6,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/reaping_flames,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/focused_azerite_beam,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/purifying_blast,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/ripple_in_space,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/the_unbound_force,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/memory_of_lucid_dreams,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down

actions.final_burn=arcane_missiles,if=buff.clearcasting.react,chain=1
actions.final_burn+=/arcane_blast
actions.final_burn+=/arcane_barrage

actions.movement=blink_any,if=movement.distance>=10
actions.movement+=/presence_of_mind
actions.movement+=/arcane_missiles,if=movement.distance<10
actions.movement+=/arcane_orb
actions.movement+=/fire_blast

actions.opener=variable,name=have_opened,op=set,value=1,if=prev_gcd.1.evocation
actions.opener+=/fire_blast,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command_frost.up
actions.opener+=/frost_nova,if=runeforge.grisly_icicle.equipped&mana.pct>95
actions.opener+=/mirrors_of_torment
actions.opener+=/deathborne
actions.opener+=/radiant_spark,if=mana.pct>40
actions.opener+=/cancel_action,if=action.shifting_power.channeling&gcd.remains=0
actions.opener+=/shifting_power,if=soulbind.field_of_blossoms.enabled
actions.opener+=/touch_of_the_magi
actions.opener+=/arcane_power
actions.opener+=/rune_of_power,if=buff.rune_of_power.down
actions.opener+=/presence_of_mind
actions.opener+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.opener+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.opener+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.opener+=/arcane_missiles,if=buff.clearcasting.react,chain=1
actions.opener+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges&(cooldown.arcane_power.remains>10|active_enemies<=2)
actions.opener+=/arcane_blast,if=buff.rune_of_power.up|mana.pct>15
actions.opener+=/evocation,if=buff.rune_of_power.down,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.opener+=/arcane_barrage

actions.rotation=variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
actions.rotation+=/strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
actions.rotation+=/arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
actions.rotation+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.rotation+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.rotation+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
actions.rotation+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
actions.rotation+=/supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.rotation+=/arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
actions.rotation+=/arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_blast
actions.rotation+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.rotation+=/arcane_barrage

actions.shared_cds=use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
actions.shared_cds+=/use_items,if=buff.arcane_power.up
actions.shared_cds+=/potion,if=buff.arcane_power.up
actions.shared_cds+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
actions.shared_cds+=/lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/berserking,if=buff.arcane_power.up
actions.shared_cds+=/blood_fury,if=buff.arcane_power.up
actions.shared_cds+=/fireblood,if=buff.arcane_power.up
actions.shared_cds+=/ancestral_call,if=buff.arcane_power.up

head=confidants_favored_cap,id=183021,bonus_id=1498,ilevel=226
neck=nobles_birthstone_pendant,id=183039,bonus_id=1498,ilevel=226
shoulders=shawl_of_the_penitent,id=183020,bonus_id=1498,ilevel=233
back=mantle_of_manifest_sins,id=183033,bonus_id=1498,ilevel=226
chest=robes_of_the_cursed_commando,id=182998,bonus_id=1498,ilevel=233,enchant=eternal_insight
wrists=acolytes_velvet_bindings,id=183017,bonus_id=1498,ilevel=226,enchant=eternal_intellect
hands=impossibly_oversized_mitts,id=183022,bonus_id=1498,ilevel=226
waist=cinch_of_infinite_tightness,id=183028,bonus_id=1498,ilevel=226
legs=courtiers_costume_trousers,id=183011,bonus_id=1498,ilevel=226
feet=slippers_of_the_forgotten_heretic,id=182979,bonus_id=1498,ilevel=226
finger1=most_regal_signet_of_sire_denathrius,id=183036,bonus_id=1498,ilevel=233,enchant=16mastery
finger2=shadowghast_ring,id=178926,bonus_id=6648/6650/6758/6834/1532,ilevel=235,enchant=16mastery
trinket1=cabalists_hymnal,id=184028,bonus_id=1498,ilevel=226
trinket2=sinful_aspirants_badge_of_ferocity,id=175884,bonus_id=1521,ilevel=207
main_hand=staff_of_the_penitent,id=180000,bonus_id=7187/6652/1524,ilevel=226,enchant=sinful_revelation

# Gear Summary
# gear_ilvl=226.73
# gear_stamina=1504
# gear_intellect=1066
# gear_crit_rating=376
# gear_haste_rating=520
# gear_mastery_rating=733
# gear_versatility_rating=319
# gear_armor=369

NightFae_Niya : 9145 dps, 3851 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
9144.8 9144.8 10.3 / 0.113% 765.0 / 8.4% 4.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
2092.7 1984.5 Mana 0.00% 53.0 100.0% 100%
Talents
Night Fae
Runeforge

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
NightFae_Niya 9145
Arcane Barrage 3374 36.9% 58.9 5.11sec 17163 14959 Direct 176.5 4821 9731 5728 18.5%

Stats Details: Arcane Barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 58.91 176.48 0.00 0.00 1.1473 0.0000 1011021.62 1011021.62 0.00% 14959.04 14959.04
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.52% 143.87 107 184 4820.60 2155 15088 4822.67 4398 5241 693548 693548 0.00%
crit 18.48% 32.61 17 54 9730.99 4309 30176 9736.87 7018 12874 317474 317474 0.00%

Action Details: Arcane Barrage

  • id:44425
  • school:arcane
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.728000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=0 + 72.8%} Arcane damage. For each Arcane Charge, deals {$36032s2=30}% additional damage$?a321526[, grants you {$321526s1=2}% of your maximum mana,][]$?a231564[ and hits {$36032s3=0} additional nearby $Ltarget:targets; for {$s2=40}% of its damage][]. |cFFFFFFFFConsumes all Arcane Charges.|r

Action Priority List

    aoe
    [p]:58.91
  • if_expr:buff.arcane_charge.stack=buff.arcane_charge.max_stack
Arcane Explosion 3899 42.6% 156.3 1.90sec 7477 6559 Direct 468.9 2095 4226 2492 18.6%

Stats Details: Arcane Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 156.31 468.92 0.00 0.00 1.1400 0.0000 1168722.84 1168722.84 0.00% 6558.67 6558.67
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.35% 381.48 289 471 2094.79 1427 4090 2095.26 1999 2195 799144 799144 0.00%
crit 18.65% 87.44 51 125 4226.29 2855 8180 4229.35 3635 4781 369579 369579 0.00%

Action Details: Arcane Explosion

  • id:1449
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.502320
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s2=0 + 50.2%} Arcane damage to all enemies within $A2 yards.$?a137021[ |cFFFFFFFFGenerates {$s1=1} Arcane Charge if any targets are hit.|r][]

Action Priority List

    aoe
    [o]:156.33
  • if_expr:buff.arcane_charge.stack<buff.arcane_charge.max_stack
Arcane Orb 0 (740) 0.0% (8.1%) 14.2 21.66sec 15570 13484

Stats Details: Arcane Orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.21 0.00 0.00 0.00 1.1547 0.0000 0.00 0.00 0.00% 13484.33 13484.33

Action Details: Arcane Orb

  • id:153626
  • school:arcane
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:153626
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r

Action Priority List

    aoe
    [m]:14.21
  • if_expr:buff.arcane_charge.stack=0
    Arcane Orb (_bolt) 740 8.1% 42.5 21.66sec 5201 0 Direct 42.5 4386 8744 5200 18.7%

Stats Details: Arcane Orb Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 42.54 42.54 0.00 0.00 0.0000 0.0000 221250.96 221250.96 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.32% 34.59 21 48 4386.48 2821 8083 4391.16 3715 4854 151732 151732 0.00%
crit 18.68% 7.95 1 18 8744.42 5642 16082 8738.58 5673 14693 69519 69519 0.00%

Action Details: Arcane Orb Bolt

  • id:153640
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.092000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:153640
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:{$@spelldesc153626=Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r}
Deathly Fixation 0 (103) 0.0% (1.1%) 22.8 7.47sec 1373 0

Stats Details: Deathly Fixation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 22.76 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Deathly Fixation

  • id:322253
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:42.90
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322253
  • name:Deathly Fixation
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1.
  • description:Deal {$s1=43} Shadow damage every $t1. Stacks up to 5 times.
    Deathly Eruption 103 1.1% 22.8 7.47sec 1373 0 Direct 22.8 1138 2277 1373 20.6%

Stats Details: Deathly Eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 22.76 22.76 0.00 0.00 0.0000 0.0000 31255.42 31255.42 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.37% 18.07 7 34 1138.15 1117 1184 1137.62 1117 1184 20564 20564 0.00%
crit 20.63% 4.70 0 12 2276.84 2233 2367 2251.59 0 2367 10691 10691 0.00%

Action Details: Deathly Eruption

  • id:322256
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:984.99
  • base_dd_max:984.99
  • base_dd_mult:1.00

Spelldata

  • id:322256
  • name:Deathly Eruption
  • school:shadow
  • tooltip:
  • description:Deal {$s1=985} Shadow damage.
Eternal Insight 40 0.4% 21.7 13.39sec 551 0 Direct 21.7 464 929 550 18.6%

Stats Details: Eternal Insight

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 21.71 21.71 0.00 0.00 0.0000 0.0000 11951.36 11951.36 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.37% 17.66 5 33 464.06 453 481 464.04 453 477 8197 8197 0.00%
crit 18.63% 4.04 0 14 928.56 907 961 913.02 0 961 3754 3754 0.00%

Action Details: Eternal Insight

  • id:342314
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:400.00
  • base_dd_max:400.00
  • base_dd_mult:1.00

Spelldata

  • id:342314
  • name:Eternal Insight
  • school:shadow
  • tooltip:
  • description:Deals {$s1=400} Shadow damage.
Frostbolt 4 0.0% 0.0 0.00sec 0 0 Direct 1.0 1024 2047 1174 14.8%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 1.00 0.00 0.00 0.0000 0.0000 1175.04 1175.04 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 85.22% 0.85 0 1 1023.69 1024 1024 872.35 0 1024 872 872 0.00%
crit 14.78% 0.15 0 1 2047.39 2047 2047 302.68 0 2047 303 303 0.00%

Action Details: Frostbolt

  • id:116
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.511000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116
  • name:Frostbolt
  • school:frost
  • tooltip:
  • description:Launches a bolt of frost at the enemy, causing {$228597s1=0} Frost damage and slowing movement speed by {$205708s1=50}% for {$205708d=8 seconds}.
Mirror Image 0 (19) 0.0% (0.2%) 1.0 0.00sec 5697 0

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.
    Frostbolt (mirror_image) 142  / 19 0.2% 117.0 0.99sec 49 48 Direct 117.0 41 82 49 19.9%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 117.00 117.00 0.00 0.00 1.0091 0.0000 5696.54 5696.54 0.00% 48.25 48.25
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.13% 93.76 79 106 40.54 30 51 40.54 39 42 3801 3801 0.00%
crit 19.87% 23.24 11 38 81.55 59 101 81.56 70 93 1896 1896 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:40.00
Shifting Power 278 3.0% 6.1 47.89sec 13663 4080 Periodic 72.8 957 1915 1145 19.6% 2.1%

Stats Details: Shifting Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.10 0.00 24.26 72.78 3.3486 0.7787 83357.23 83357.23 0.00% 4080.34 4080.34
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.39% 58.51 39 78 957.49 949 1006 957.51 949 972 56023 56023 0.00%
crit 19.61% 14.27 3 28 1915.13 1898 2011 1915.19 1898 1970 27334 27334 0.00%

Action Details: Shifting Power

  • id:314791
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:4.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:314791
  • name:Shifting Power
  • school:nature
  • tooltip:Every $t1 sec, deal {$325130s1=0} Nature damage to enemies within $325130A1 yds and reduce the remaining cooldown of your abilities by ${-{$s2=3000}/1000} sec.
  • description:Draw power from the ground beneath, dealing ${{$325130s1=0}*{$d=4 seconds}/$t} Nature damage over {$d=4 seconds} to enemies within $325130A1 yds. While channeling, your Mage ability cooldowns are reduced by ${-{$s2=3000}/1000*{$d=4 seconds}/$t} sec over {$d=4 seconds}.

Action Details: Shifting Power Pulse

  • id:325130
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:18.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.473600
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:325130
  • name:Shifting Power
  • school:nature
  • tooltip:
  • description:{$@spelldesc314791=Draw power from the ground beneath, dealing ${{$325130s1=0}*{$d=4 seconds}/$t} Nature damage over {$d=4 seconds} to enemies within $325130A1 yds. While channeling, your Mage ability cooldowns are reduced by ${-{$s2=3000}/1000*{$d=4 seconds}/$t} sec over {$d=4 seconds}.}

Action Priority List

    aoe
    [n]:6.10
  • if_expr:buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
Touch of the Magi 0 (688) 0.0% (7.5%) 7.0 45.72sec 29264 23186

Stats Details: Touch Of The Magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 7.04 0.00 0.00 0.00 1.2622 0.0000 0.00 0.00 0.00% 23186.18 23186.18

Action Details: Touch Of The Magi

  • id:321507
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:4.0

Spelldata

  • id:321507
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]

Action Priority List

    aoe
    [j]:7.07
  • if_expr:buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
    Touch of the Magi (_explosion) 688 7.5% 7.0 45.56sec 29264 0 Direct 21.0 9806 0 9806 0.0%

Stats Details: Touch Of The Magi Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 7.04 21.00 0.00 0.00 0.0000 0.0000 205916.44 205916.44 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 21.00 15 27 9805.75 1480 42810 9902.68 6804 14125 205916 205916 0.00%

Action Details: Touch Of The Magi Explosion

  • id:210833
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:18544.78
  • base_dd_max:18544.78
  • base_dd_mult:1.00

Spelldata

  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc321507=Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]}
Simple Action Stats Execute Interval
NightFae_Niya
Arcane Power 3.6 97.58sec

Stats Details: Arcane Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.55 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Power

  • id:12042
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].

Action Priority List

    aoe
    [k]:3.56
  • if_expr:((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
Berserking 2.0 194.88sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    shared_cds
    [v]:2.00
  • if_expr:buff.arcane_power.up
Conjure Mana Gem 1.0 0.00sec

Stats Details: Conjure Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Conjure Mana Gem

  • id:759
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:9000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:759
  • name:Conjure Mana Gem
  • school:arcane
  • tooltip:
  • description:Conjures a Mana Gem that can be used to instantly restore {$5405s1=10}% mana, and holds up to {$s2=3} charges. $@spellname118812 {$@spelldesc118812=Conjured items disappear if logged out for more than 15 minutes.}
Evocation 0.1 0.00sec

Stats Details: Evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.14 0.00 0.84 0.00 3.6946 0.6356 0.00 0.00 0.00% 0.00 0.00

Action Details: Evocation

  • id:12051
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Niya
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.

Action Priority List

    aoe
    [q]:0.15
  • interrupt_if_expr:mana.pct>=85
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Niya
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Niya
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Deathly Fixation (potion) 1.5 300.54sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.49 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307497
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    shared_cds
    [t]:1.48
  • if_expr:buff.arcane_power.up
Rune of Power 6.9 43.99sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.94 0.00 0.00 0.00 1.1858 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    aoe
    [l]:6.96
  • if_expr:buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Time Warp 2.0 240.34sec

Stats Details: Time Warp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.99 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Time Warp

  • id:80353
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:2000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:80353
  • name:Time Warp
  • school:arcane
  • tooltip:Haste increased by $w1%. $?$W4>0[Time rate increased by $w4%.][]$?$W3=1[ When the effect ends, you die.][]
  • description:Warp the flow of time, increasing haste by {$s1=30}% $?a320919[and time rate by {$s4=0}% ][]for all party and raid members for {$d=40 seconds}. Allies will be unable to benefit from Bloodlust, Heroism, or Time Warp again for {$57724d=600 seconds}.$?a320920[ When the effect ends, you die.][]

Action Priority List

    shared_cds
    [u]:1.99
  • if_expr:runeforge.temporal_warp.equipped&buff.exhaustion.up
Replenish Mana (use_mana_gem) 2.8 120.90sec

Stats Details: Use Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.84 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Use Mana Gem

  • id:5405
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Niya
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5405
  • name:Replenish Mana
  • school:physical
  • tooltip:Restoring $w2 mana every $t1 sec.
  • description:Restores {$s1=10}% mana.

Action Priority List

    shared_cds
    [r]:2.84
  • if_expr:(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Arcane Charge 59.7 160.4 5.0sec 1.4sec 3.7sec 73.69% 0.00% 2.6 (3.7) 0.0

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.8s / 14.6s
  • trigger_min/max:0.0s / 9.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 13.3s

Stack Uptimes

  • arcane_charge_1:18.83%
  • arcane_charge_2:16.17%
  • arcane_charge_3:17.13%
  • arcane_charge_4:21.56%

Spelldata

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 3.6 0.0 97.6sec 97.6sec 14.7sec 17.42% 0.00% 0.0 (0.0) 3.4

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:96.0s / 112.7s
  • trigger_min/max:96.0s / 112.7s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 15.0s

Stack Uptimes

  • arcane_power_1:17.42%

Spelldata

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Berserking 2.0 0.0 194.9sec 194.9sec 12.0sec 8.11% 6.52% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:192.5s / 201.2s
  • trigger_min/max:192.5s / 201.2s
  • trigger_pct:100.00%
  • duration_min/max:12.0s / 12.0s

Stack Uptimes

  • berserking_1:8.11%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.51% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.51%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Clearcasting 24.7 0.3 11.8sec 11.7sec 2.0sec 16.73% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_clearcasting
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • clearcasting_1:16.37%
  • clearcasting_2:0.36%
  • clearcasting_3:0.01%

Spelldata

  • id:263725
  • name:Clearcasting
  • tooltip:Your next Arcane Missiles or Arcane Explosion costs no mana{$?s321758=false}[ and Arcane Missiles fires an additional missile][].
  • description:{$@spelldesc79684=For each ${$c*100/{$s1=200}} mana you spend, you have a 1% chance to gain Clearcasting, making your next Arcane Missiles or Arcane Explosion free and channel {$277726s1=20}% faster.$?a321758[ Arcane Missiles fires {$321758s2=1} additional missile.][]}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Crimson Chorus 5.5 0.0 60.6sec 60.6sec 28.6sec 52.03% 0.00% 0.0 (0.0) 4.9

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_crimson_chorus
  • max_stacks:3
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:60.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:10.00
  • associated item:Cabalist's Hymnal

Stat Details

  • stat:crit_rating
  • amount:95.00

Trigger Details

  • interval_min/max:60.0s / 65.0s
  • trigger_min/max:60.0s / 65.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 30.0s

Stack Uptimes

  • crimson_chorus_1:17.94%
  • crimson_chorus_2:17.34%
  • crimson_chorus_3:16.75%

Spelldata

  • id:344803
  • name:Crimson Chorus
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc344806=Join the Crimson Chorus. Every minute, your Critical Strike swells by ${{$s1=44}*3} over ${{$344803d=10 seconds}*3} sec. before returning to normal. This effect is increased by {$s2=5}% for each member of the Crimson Chorus in your party.}
  • max_stacks:3
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Evocation 0.1 0.0 191.8sec 191.8sec 3.7sec 0.17% 0.00% 0.6 (0.6) 0.0

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_evocation
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:7.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:1.00

Trigger Details

  • interval_min/max:187.7s / 195.9s
  • trigger_min/max:187.7s / 195.9s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 4.3s

Stack Uptimes

  • evocation_1:0.18%

Spelldata

  • id:12051
  • name:Evocation
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Gladiator's Badge 3.6 0.0 97.6sec 97.6sec 14.7sec 17.42% 0.00% 0.0 (0.0) 3.4

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_gladiators_badge
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Sinful Aspirant's Badge of Ferocity

Stat Details

  • stat:intellect
  • amount:342.00

Trigger Details

  • interval_min/max:96.0s / 112.7s
  • trigger_min/max:96.0s / 112.7s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 15.0s

Stack Uptimes

  • gladiators_badge_1:17.42%

Spelldata

  • id:345228
  • name:Gladiator's Badge
  • tooltip:Primary stat increased by $w1.
  • description:Increases primary stat by {$s1=252} for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:0.00%
Potion of Deathly Fixation 1.5 0.0 300.5sec 300.5sec 23.1sec 11.27% 0.00% 0.0 (0.0) 1.3

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_potion_of_deathly_fixation
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:300.0s / 306.5s
  • trigger_min/max:300.0s / 306.5s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 25.0s

Stack Uptimes

  • potion_of_deathly_fixation_1:11.27%

Spelldata

  • id:307497
  • name:Potion of Deathly Fixation
  • tooltip:Chance to apply Deathly Fixation to your target.
  • description:Your damaging spells and abilities have a chance to apply Deathly Fixation to your target, dealing {$322253s1=43} Shadow damage over {$322253d=8 seconds} and stacking up to 5 times. Upon reaching 5 stacks, Deathly Fixation explodes, dealing {$322256s1=985} Shadow damage to the target. If you consume this potion while your weapon is augmented with Shadowcore Oil, the explosion damage is increased by {$s2=10}%. Lasts {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Redirected Anima 16.8 0.0 53.7sec 16.9sec 67.5sec 84.69% 0.00% 0.0 (0.0) 2.9

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_redirected_anima
  • max_stacks:50
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:25.00

Trigger Details

  • interval_min/max:0.3s / 325.3s
  • trigger_min/max:0.3s / 68.6s
  • trigger_pct:98.39%
  • duration_min/max:0.1s / 347.9s

Stack Uptimes

  • redirected_anima_1:16.22%
  • redirected_anima_2:7.31%
  • redirected_anima_3:2.27%
  • redirected_anima_4:0.42%
  • redirected_anima_5:0.07%
  • redirected_anima_6:16.98%
  • redirected_anima_7:24.64%
  • redirected_anima_8:12.03%
  • redirected_anima_9:3.78%
  • redirected_anima_10:0.84%
  • redirected_anima_11:0.17%
  • redirected_anima_12:0.03%
  • redirected_anima_13:0.02%

Spelldata

  • id:342814
  • name:Redirected Anima
  • tooltip:Max health increased by $w1%. Mastery increased by $w2.
  • description:{$@spelldesc322721=Healing or dealing damage has a chance to grant you a stack of Redirected Anima. Redirected Anima increases your maximum health by {$342814s1=1}% and your Mastery by {$342814s2=25} for {$342814d=30 seconds}, and stacks overlap. $?(s152280&a137005)[Defile]?(a137005&!s152280)[Death's Due]?a212611[The Hunt]?a137009[Convoke the Spirits]?a137014[Wild Spirits]?a137018[Shifting Power]?a137022[Faeline Stomp]?a137026[Blessing of Seasons]?a137030[Fae Guardians]?a137034[Sepsis]?a137038[Fae Transfusion]?a137042[Soul Rot]?a137047[Ancient Aftershock][Activating your Night Fae class ability] grants you ${{$s3=8}*$<mod>} stacks of Redirected Anima.}
  • max_stacks:50
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Rune of Power 10.5 0.0 29.6sec 29.6sec 11.8sec 41.15% 0.00% 0.0 (0.0) 10.1

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.0s / 55.0s
  • trigger_min/max:13.0s / 55.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • rune_of_power_1:41.15%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Temporal Warp 2.0 0.0 240.4sec 240.4sec 36.8sec 24.26% 0.00% 0.0 (0.0) 1.7

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_temporal_warp
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:240.0s / 241.0s
  • trigger_min/max:240.0s / 241.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 40.0s

Stack Uptimes

  • temporal_warp_1:24.26%

Spelldata

  • id:327355
  • name:Temporal Warp
  • tooltip:Haste increased by $w1%.
  • description:{$@spelldesc327351=While you have Temporal Displacement or other similar effects, you may use Time Warp to grant yourself {$327355s1=30}% Haste for {$327355d=40 seconds}.}
  • max_stacks:0
  • duration:40.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism)

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Benefit Avg % Min Max
Arcane Barrage Arcane Charge 4 100.00% 100.00% 100.00%
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 1.20% 0.35% 7.83% 0.8s 0.0s 6.1s
Conserve Phase 100.00% 100.00% 100.00% 299.9s 240.2s 360.0s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.0000.0000.000203.943144.203263.964
Evocation243.24869.050353.141293.655163.188359.335
Rune of Power8.3060.00337.63359.68920.617113.011
Touch of the Magi7.3960.00022.04353.36017.180110.485
Arcane Power1.5280.00016.7255.4691.88519.811
Arcane Barrage2.8130.00011.974166.840134.025200.924
Arcane Orb3.7230.00011.44253.46135.77070.648
Shifting Power6.9740.00036.99844.12629.81267.466
Time Warp0.8290.0001.3031.6481.2972.346

Burn Phases

Burn phase duration tracks the amount of time spent in each burn phase. This is defined as the time between a start_burn_phase and stop_burn_phase action being executed. Note that "execute" burn phases, i.e., the final burn of a fight, is also included.

Burn Phase Duration
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Mana at burn start is the mana level recorded (in percentage of total mana) when a start_burn_phase command is executed.

Mana at Burn Start
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
NightFae_Niya
mana_regen Mana 706.10 409505.42 68.78% 579.95 5750.31 1.38%
Evocation Mana 6.16 7598.36 1.28% 1233.14 0.00 0.00%
Mana Gem Mana 2.84 19632.76 3.30% 6906.39 0.00 0.00%
Arcane Barrage Mana 58.91 158628.98 26.64% 2692.90 4545.73 2.79%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 66365.7 1984.53 2092.68 10292.2 34602.1 378.0 67365.7
Usage Type Count Total Avg RPE APR
NightFae_Niya
arcane_explosion Mana 156.3 583722.8 3733.9 3734.5 2.0
arcane_orb Mana 14.2 6303.0 443.6 443.6 35.1
shifting_power Mana 6.1 15249.1 2500.0 2499.5 5.5
time_warp Mana 2.0 3973.0 2000.0 2000.2 0.0
touch_of_the_magi Mana 7.0 17578.7 2498.4 2498.2 11.7

Statistics & Data Analysis

Fight Length
NightFae_Niya Fight Length
Count 1319
Mean 299.94
Minimum 240.20
Maximum 359.96
Spread ( max - min ) 119.76
Range [ ( max - min ) / 2 * 100% ] 19.96%
DPS
NightFae_Niya Damage Per Second
Count 1319
Mean 9144.79
Minimum 8555.46
Maximum 9692.10
Spread ( max - min ) 1136.65
Range [ ( max - min ) / 2 * 100% ] 6.21%
Standard Deviation 191.5191
5th Percentile 8830.52
95th Percentile 9467.01
( 95th Percentile - 5th Percentile ) 636.49
Mean Distribution
Standard Deviation 5.2734
95.00% Confidence Interval ( 9134.45 - 9155.12 )
Normalized 95.00% Confidence Interval ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 17
0.1% Error 1685
0.1 Scale Factor Error with Delta=300 314
0.05 Scale Factor Error with Delta=300 1253
0.01 Scale Factor Error with Delta=300 31312
Priority Target DPS
NightFae_Niya Priority Target Damage Per Second
Count 1319
Mean 3850.97
Minimum 3485.00
Maximum 4274.22
Spread ( max - min ) 789.22
Range [ ( max - min ) / 2 * 100% ] 10.25%
Standard Deviation 122.2930
5th Percentile 3661.19
95th Percentile 4054.97
( 95th Percentile - 5th Percentile ) 393.78
Mean Distribution
Standard Deviation 3.3673
95.00% Confidence Interval ( 3844.37 - 3857.57 )
Normalized 95.00% Confidence Interval ( 99.83% - 100.17% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 39
0.1% Error 3875
0.1 Scale Factor Error with Delta=300 128
0.05 Scale Factor Error with Delta=300 511
0.01 Scale Factor Error with Delta=300 12767
DPS(e)
NightFae_Niya Damage Per Second (Effective)
Count 1319
Mean 9144.79
Minimum 8555.46
Maximum 9692.10
Spread ( max - min ) 1136.65
Range [ ( max - min ) / 2 * 100% ] 6.21%
Damage
NightFae_Niya Damage
Count 1319
Mean 2734650.91
Minimum 2173040.03
Maximum 3284864.74
Spread ( max - min ) 1111824.70
Range [ ( max - min ) / 2 * 100% ] 20.33%
DTPS
NightFae_Niya Damage Taken Per Second
Count 1319
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
NightFae_Niya Healing Per Second
Count 1319
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
NightFae_Niya Healing Per Second (Effective)
Count 1319
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
NightFae_Niya Heal
Count 1319
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
NightFae_Niya Healing Taken Per Second
Count 1319
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
NightFae_Niya Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
NightFae_NiyaTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
NightFae_Niya Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 variable,name=prepull_evo,op=reset,default=0
1 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
2 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
3 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
4 0.00 variable,name=have_opened,op=reset,default=0
5 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
6 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
7 0.00 variable,name=final_burn,op=set,value=0
8 0.00 variable,name=rs_max_delay,op=reset,default=5
9 0.00 variable,name=ap_max_delay,op=reset,default=10
A 0.00 variable,name=rop_max_delay,op=reset,default=20
B 0.00 variable,name=totm_max_delay,op=reset,default=5
C 0.00 variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
D 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
E 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
F 0.00 variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
G 0.00 variable,name=barrage_mana_pct,op=reset,default=70
H 0.00 variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
I 0.00 variable,name=ap_minimum_mana_pct,op=reset,default=30
J 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
K 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
L 0.00 variable,name=totm_max_charges,op=reset,default=2
M 0.00 variable,name=aoe_totm_max_charges,op=reset,default=2
N 0.00 variable,name=am_spam,op=reset,default=0
O 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
P 0.00 variable,name=am_spam_evo_pct,op=reset,default=15
Q 0.00 flask
R 0.00 food
S 0.00 augmentation
T 0.00 arcane_familiar
U 0.00 arcane_intellect
V 0.00 conjure_mana_gem
W 0.00 snapshot_stats
X 0.00 mirror_image
Y 0.00 frostbolt,if=variable.prepull_evo<=0
Z 0.00 evocation,if=variable.prepull_evo>0
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
a 0.00 call_action_list,name=shared_cds
b 0.00 call_action_list,name=essences
c 0.00 call_action_list,name=aoe,if=active_enemies>2
d 0.00 call_action_list,name=opener,if=variable.have_opened<=0
e 0.00 call_action_list,name=am_spam,if=variable.am_spam=1
f 0.00 call_action_list,name=cooldowns
g 0.00 call_action_list,name=rotation,if=variable.final_burn=0
h 0.00 call_action_list,name=final_burn,if=variable.final_burn=1
i 0.00 call_action_list,name=movement
actions.aoe
# count action,conditions
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
0.00 arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
0.00 mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
j 7.07 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
k 3.56 arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
l 6.96 rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
0.00 presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
0.00 arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
0.00 supernova
m 14.21 arcane_orb,if=buff.arcane_charge.stack=0
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
n 6.10 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
o 156.33 arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
0.00 arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
p 58.91 arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
q 0.15 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.shared_cds
# count action,conditions
r 2.84 use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
s 3.56 use_items,if=buff.arcane_power.up
t 1.48 potion,if=buff.arcane_power.up
u 1.99 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
0.00 lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
v 2.00 berserking,if=buff.arcane_power.up
0.00 blood_fury,if=buff.arcane_power.up
0.00 fireblood,if=buff.arcane_power.up
0.00 ancestral_call,if=buff.arcane_power.up

Sample Sequence

045789ABDGHILMNPQRVXYjukstvpmpoooopoooopoooolpoooropoooopmpooonopoooopmpoooopoooopojlpoooopmpoooopoooonpmpoooopoooopoooopjkspmpoooopoooolpoooopmpoonooprmpoooopoojlpoooopmpoooopoooopnmpoooopoooopojksvpoooopmpoooolpoooopoooonpmpoooopouooopjlpoooopmpoooropoooopooooponooopmpoooopoooopjkspooooptmpoooolpoooopoooonpmpoooopoooopjlpoo

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 prepull_evo Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat 4 have_opened Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat 5 have_opened Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat 7 final_burn Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat 8 rs_max_delay Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat 9 ap_max_delay Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat A rop_max_delay Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat B totm_max_delay Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat D totm_max_delay Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat G barrage_mana_pct Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat H barrage_mana_pct Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat I ap_minimum_mana_pct Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat L totm_max_charges Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat M aoe_totm_max_charges Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat N am_spam Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat P am_spam_evo_pct Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat Q flask NightFae_Niya 67365.7/67366: 100% mana
Pre precombat R food NightFae_Niya 67365.7/67366: 100% mana
Pre precombat V conjure_mana_gem Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat X mirror_image Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat Y frostbolt Fluffy_Pillow 67365.7/67366: 100% mana
0:00.000 aoe j touch_of_the_magi Fluffy_Pillow 66365.7/67366: 99% mana
0:01.300 shared_cds u time_warp Fluffy_Pillow 64872.5/67366: 96% mana bloodlust, arcane_charge(4), crimson_chorus
0:01.300 aoe k arcane_power Fluffy_Pillow 62872.5/67366: 93% mana bloodlust, arcane_charge(4), temporal_warp, crimson_chorus
0:01.300 shared_cds s use_items Fluffy_Pillow 62872.5/67366: 93% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, crimson_chorus
0:01.300 shared_cds t potion Fluffy_Pillow 62872.5/67366: 93% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, crimson_chorus, gladiators_badge
0:01.300 shared_cds v berserking Fluffy_Pillow 62872.5/67366: 93% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:01.300 aoe p arcane_barrage Fluffy_Pillow 62872.5/67366: 93% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:02.055 aoe m arcane_orb Fluffy_Pillow 66584.3/67366: 99% mana bloodlust, berserking, arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:02.810 aoe p arcane_barrage Fluffy_Pillow 67351.5/67366: 100% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:03.564 aoe o arcane_explosion Fluffy_Pillow 67365.7/67366: 100% mana bloodlust, berserking, arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:04.318 aoe o arcane_explosion Fluffy_Pillow 65881.6/67366: 98% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:05.073 aoe o arcane_explosion Fluffy_Pillow 64398.8/67366: 96% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:05.827 aoe o arcane_explosion Fluffy_Pillow 62914.7/67366: 93% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:06.582 aoe p arcane_barrage Fluffy_Pillow 61431.9/67366: 91% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:07.338 aoe o arcane_explosion Fluffy_Pillow 65145.1/67366: 97% mana bloodlust, berserking, arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:08.093 aoe o arcane_explosion Fluffy_Pillow 63662.3/67366: 95% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:08.846 aoe o arcane_explosion Fluffy_Pillow 62176.9/67366: 92% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:09.601 aoe o arcane_explosion Fluffy_Pillow 60694.1/67366: 90% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:10.356 aoe p arcane_barrage Fluffy_Pillow 59211.3/67366: 88% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:11.110 aoe o arcane_explosion Fluffy_Pillow 62921.8/67366: 93% mana bloodlust, berserking, arcane_power, rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:11.864 aoe o arcane_explosion Fluffy_Pillow 61437.7/67366: 91% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:12.619 aoe o arcane_explosion Fluffy_Pillow 59954.9/67366: 89% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:13.374 aoe o arcane_explosion Fluffy_Pillow 58472.1/67366: 87% mana bloodlust, arcane_charge(3), arcane_power, clearcasting, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:14.143 aoe l rune_of_power Fluffy_Pillow 59508.2/67366: 88% mana bloodlust, arcane_charge(4), arcane_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:14.914 aoe p arcane_barrage Fluffy_Pillow 60547.0/67366: 90% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:15.685 aoe o arcane_explosion Fluffy_Pillow 64280.4/67366: 95% mana bloodlust, arcane_power, rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:16.454 aoe o arcane_explosion Fluffy_Pillow 62816.5/67366: 93% mana bloodlust, arcane_charge, rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation
0:17.224 aoe o arcane_explosion Fluffy_Pillow 58853.9/67366: 87% mana bloodlust, arcane_charge(2), rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation
0:17.995 shared_cds r use_mana_gem NightFae_Niya 54892.7/67366: 81% mana bloodlust, arcane_charge(3), rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation
0:17.995 aoe o arcane_explosion Fluffy_Pillow 61629.3/67366: 91% mana bloodlust, arcane_charge(3), rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation
0:18.766 aoe p arcane_barrage Fluffy_Pillow 57668.0/67366: 86% mana bloodlust, arcane_charge(4), rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation
0:19.538 aoe o arcane_explosion Fluffy_Pillow 61402.8/67366: 91% mana bloodlust, rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation
0:20.308 aoe o arcane_explosion Fluffy_Pillow 57440.2/67366: 85% mana bloodlust, arcane_charge, rune_of_power, temporal_warp, crimson_chorus(3), potion_of_deathly_fixation
0:21.078 aoe o arcane_explosion Fluffy_Pillow 53477.7/67366: 79% mana bloodlust, arcane_charge(2), rune_of_power, temporal_warp, crimson_chorus(3), potion_of_deathly_fixation
0:21.850 aoe o arcane_explosion Fluffy_Pillow 49517.8/67366: 74% mana bloodlust, arcane_charge(3), rune_of_power, temporal_warp, crimson_chorus(3), potion_of_deathly_fixation
0:22.621 aoe p arcane_barrage Fluffy_Pillow 45556.6/67366: 68% mana bloodlust, arcane_charge(4), clearcasting, rune_of_power, temporal_warp, crimson_chorus(3), potion_of_deathly_fixation
0:23.392 aoe m arcane_orb Fluffy_Pillow 49290.0/67366: 73% mana bloodlust, clearcasting, rune_of_power, temporal_warp, crimson_chorus(3), potion_of_deathly_fixation
0:24.164 aoe p arcane_barrage Fluffy_Pillow 49830.1/67366: 74% mana bloodlust, arcane_charge(4), clearcasting, rune_of_power, temporal_warp, crimson_chorus(3), potion_of_deathly_fixation
0:24.935 aoe o arcane_explosion Fluffy_Pillow 53563.5/67366: 80% mana bloodlust, clearcasting, rune_of_power, temporal_warp, crimson_chorus(3), potion_of_deathly_fixation
0:25.706 aoe o arcane_explosion Fluffy_Pillow 54602.3/67366: 81% mana bloodlust, arcane_charge, rune_of_power, temporal_warp, crimson_chorus(3), potion_of_deathly_fixation
0:26.476 aoe o arcane_explosion Fluffy_Pillow 50639.7/67366: 75% mana bloodlust, arcane_charge(2), clearcasting, rune_of_power, temporal_warp, crimson_chorus(3)
0:27.247 aoe n shifting_power Fluffy_Pillow 51678.5/67366: 77% mana bloodlust, arcane_charge(3), temporal_warp, crimson_chorus(3)
0:29.565 aoe o arcane_explosion Fluffy_Pillow 54630.7/70366: 78% mana bloodlust, arcane_charge(3), temporal_warp, crimson_chorus(3), redirected_anima(7)
0:30.338 aoe p arcane_barrage Fluffy_Pillow 50718.6/70366: 72% mana bloodlust, arcane_charge(4), temporal_warp, redirected_anima(7)
0:31.109 aoe o arcane_explosion Fluffy_Pillow 54618.2/70366: 78% mana bloodlust, temporal_warp, redirected_anima(7)
0:31.878 aoe o arcane_explosion Fluffy_Pillow 50700.5/70366: 72% mana bloodlust, arcane_charge, temporal_warp, redirected_anima(7)
0:32.649 aoe o arcane_explosion Fluffy_Pillow 46785.5/70366: 66% mana bloodlust, arcane_charge(2), temporal_warp, redirected_anima(7)
0:33.421 aoe o arcane_explosion Fluffy_Pillow 42872.0/70366: 61% mana bloodlust, arcane_charge(3), clearcasting, temporal_warp, redirected_anima(7)
0:34.191 aoe p arcane_barrage Fluffy_Pillow 43955.6/70366: 62% mana bloodlust, arcane_charge(4), temporal_warp, redirected_anima(7)
0:34.960 aoe m arcane_orb Fluffy_Pillow 47852.4/70366: 68% mana bloodlust, temporal_warp, redirected_anima(7)
0:35.732 aoe p arcane_barrage Fluffy_Pillow 48438.9/70366: 69% mana bloodlust, arcane_charge(4), temporal_warp, redirected_anima(7)
0:36.504 aoe o arcane_explosion Fluffy_Pillow 52340.0/70366: 74% mana bloodlust, temporal_warp, redirected_anima(7)
0:37.275 aoe o arcane_explosion Fluffy_Pillow 48425.0/70366: 69% mana bloodlust, arcane_charge, clearcasting, temporal_warp, redirected_anima(7)
0:38.045 aoe o arcane_explosion Fluffy_Pillow 49508.6/70366: 70% mana bloodlust, arcane_charge(2), temporal_warp, redirected_anima(7)
0:38.816 aoe o arcane_explosion Fluffy_Pillow 45593.7/70366: 65% mana bloodlust, arcane_charge(3), temporal_warp, redirected_anima(7)
0:39.586 aoe p arcane_barrage Fluffy_Pillow 41677.3/70366: 59% mana bloodlust, arcane_charge(4), temporal_warp, redirected_anima(7)
0:40.356 aoe o arcane_explosion Fluffy_Pillow 45575.6/70366: 65% mana bloodlust, temporal_warp, redirected_anima(7)
0:41.127 aoe o arcane_explosion Fluffy_Pillow 41660.6/70366: 59% mana arcane_charge, temporal_warp, redirected_anima(7)
0:42.129 aoe o arcane_explosion Fluffy_Pillow 38070.7/70366: 54% mana arcane_charge(2), clearcasting, redirected_anima(7)
0:43.427 aoe o arcane_explosion Fluffy_Pillow 39897.4/70366: 57% mana arcane_charge(3), redirected_anima(7)
0:44.727 aoe p arcane_barrage Fluffy_Pillow 36726.9/70366: 52% mana arcane_charge(4), redirected_anima(7)
0:46.026 aoe o arcane_explosion Fluffy_Pillow 41369.7/70366: 59% mana redirected_anima(7)
0:47.325 aoe j touch_of_the_magi Fluffy_Pillow 38197.8/70366: 54% mana arcane_charge, redirected_anima(7)
0:48.625 aoe l rune_of_power Fluffy_Pillow 37527.3/70366: 53% mana arcane_charge(4), redirected_anima(7)
0:49.924 aoe p arcane_barrage Fluffy_Pillow 39355.4/70366: 56% mana arcane_charge(4), rune_of_power, redirected_anima(7)
0:51.224 aoe o arcane_explosion Fluffy_Pillow 43999.5/70366: 63% mana rune_of_power, redirected_anima(7)
0:52.524 aoe o arcane_explosion Fluffy_Pillow 40829.0/70366: 58% mana arcane_charge, rune_of_power, redirected_anima(7)
0:53.824 aoe o arcane_explosion Fluffy_Pillow 37658.5/70366: 54% mana arcane_charge(2), rune_of_power, redirected_anima(7)
0:55.124 aoe o arcane_explosion Fluffy_Pillow 34488.0/70366: 49% mana arcane_charge(3), rune_of_power, redirected_anima(7)
0:56.423 aoe p arcane_barrage Fluffy_Pillow 31316.1/70366: 45% mana arcane_charge(4), rune_of_power, redirected_anima(7)
0:57.722 aoe m arcane_orb Fluffy_Pillow 34425.8/67366: 51% mana rune_of_power
0:59.022 aoe p arcane_barrage Fluffy_Pillow 35677.3/67366: 53% mana arcane_charge(4), rune_of_power
1:00.322 aoe o arcane_explosion Fluffy_Pillow 40123.4/67366: 60% mana rune_of_power
1:01.621 aoe o arcane_explosion Fluffy_Pillow 36873.6/67366: 55% mana arcane_charge, rune_of_power, crimson_chorus
1:02.921 aoe o arcane_explosion Fluffy_Pillow 33625.1/67366: 50% mana arcane_charge(2), crimson_chorus
1:04.221 aoe o arcane_explosion Fluffy_Pillow 30376.6/67366: 45% mana arcane_charge(3), crimson_chorus
1:05.521 aoe p arcane_barrage Fluffy_Pillow 27128.1/67366: 40% mana arcane_charge(4), crimson_chorus
1:06.821 aoe o arcane_explosion Fluffy_Pillow 31574.3/67366: 47% mana crimson_chorus
1:08.121 aoe o arcane_explosion Fluffy_Pillow 28325.8/67366: 42% mana arcane_charge, crimson_chorus
1:09.420 aoe o arcane_explosion Fluffy_Pillow 25075.9/67366: 37% mana arcane_charge(2), crimson_chorus
1:10.720 aoe o arcane_explosion Fluffy_Pillow 21827.4/67366: 32% mana arcane_charge(3), clearcasting, crimson_chorus(2)
1:12.019 aoe n shifting_power Fluffy_Pillow 23577.6/67366: 35% mana arcane_charge(4), crimson_chorus(2)
1:15.879 aoe p arcane_barrage Fluffy_Pillow 27281.3/69937: 39% mana arcane_charge(4), crimson_chorus(2), redirected_anima(6)
1:17.179 aoe m arcane_orb Fluffy_Pillow 31897.2/69937: 46% mana crimson_chorus(2), redirected_anima(6)
1:18.479 aoe p arcane_barrage Fluffy_Pillow 33215.5/69937: 47% mana arcane_charge(4), crimson_chorus(2), redirected_anima(6)
1:19.778 aoe o arcane_explosion Fluffy_Pillow 37830.0/69937: 54% mana crimson_chorus(2), redirected_anima(6)
1:21.077 aoe o arcane_explosion Fluffy_Pillow 34646.9/69937: 50% mana arcane_charge, crimson_chorus(3), redirected_anima(6)
1:22.376 aoe o arcane_explosion Fluffy_Pillow 31463.9/69937: 45% mana arcane_charge(2), clearcasting, crimson_chorus(3), redirected_anima(6)
1:23.675 aoe o arcane_explosion Fluffy_Pillow 33280.9/69937: 48% mana arcane_charge(3), crimson_chorus(3), redirected_anima(6)
1:24.976 aoe p arcane_barrage Fluffy_Pillow 30100.6/69937: 43% mana arcane_charge(4), crimson_chorus(3), redirected_anima(6)
1:26.277 aoe o arcane_explosion Fluffy_Pillow 34717.9/69937: 50% mana crimson_chorus(3), redirected_anima(6)
1:27.576 aoe o arcane_explosion Fluffy_Pillow 31534.9/69937: 45% mana arcane_charge, crimson_chorus(3), redirected_anima(6)
1:28.875 aoe o arcane_explosion Fluffy_Pillow 28351.8/69937: 41% mana arcane_charge(2), clearcasting, crimson_chorus(3), redirected_anima(6)
1:30.175 aoe o arcane_explosion Fluffy_Pillow 30170.2/69937: 43% mana arcane_charge(3), crimson_chorus(3), redirected_anima(6)
1:31.475 aoe p arcane_barrage Fluffy_Pillow 27153.9/70366: 39% mana arcane_charge(4), redirected_anima(7)
1:32.774 aoe o arcane_explosion Fluffy_Pillow 31796.7/70366: 45% mana redirected_anima(7)
1:34.072 aoe o arcane_explosion Fluffy_Pillow 28623.4/70366: 41% mana arcane_charge, clearcasting, redirected_anima(7)
1:35.372 aoe o arcane_explosion Fluffy_Pillow 30452.9/70366: 43% mana arcane_charge(2), redirected_anima(7)
1:36.672 aoe o arcane_explosion Fluffy_Pillow 27282.4/70366: 39% mana arcane_charge(3), redirected_anima(7)
1:37.971 aoe p arcane_barrage Fluffy_Pillow 24257.3/70794: 34% mana arcane_charge(4), redirected_anima(8)
1:39.270 aoe j touch_of_the_magi Fluffy_Pillow 28928.3/70794: 41% mana redirected_anima(8)
1:40.570 aoe k arcane_power Fluffy_Pillow 28269.0/70794: 40% mana arcane_charge(4), redirected_anima(8)
1:40.570 shared_cds s use_items Fluffy_Pillow 28269.0/70794: 40% mana arcane_charge(4), arcane_power, rune_of_power, redirected_anima(8)
1:40.570 aoe p arcane_barrage Fluffy_Pillow 28269.0/70794: 40% mana arcane_charge(4), arcane_power, rune_of_power, redirected_anima(8), gladiators_badge
1:41.870 aoe m arcane_orb Fluffy_Pillow 32941.4/70794: 47% mana arcane_power, rune_of_power, redirected_anima(8), gladiators_badge
1:43.169 aoe p arcane_barrage Fluffy_Pillow 33276.4/68223: 49% mana arcane_charge(4), arcane_power, rune_of_power, redirected_anima(2), gladiators_badge
1:44.468 aoe o arcane_explosion Fluffy_Pillow 37777.7/68223: 55% mana arcane_power, rune_of_power, redirected_anima(2), gladiators_badge
1:45.768 aoe o arcane_explosion Fluffy_Pillow 37051.5/68223: 54% mana arcane_charge, arcane_power, rune_of_power, redirected_anima(2), gladiators_badge
1:47.068 aoe o arcane_explosion Fluffy_Pillow 36325.3/68223: 53% mana arcane_charge(2), arcane_power, rune_of_power, redirected_anima(2), gladiators_badge
1:48.368 aoe o arcane_explosion Fluffy_Pillow 35599.1/68223: 52% mana arcane_charge(3), arcane_power, rune_of_power, redirected_anima(2), gladiators_badge
1:49.668 aoe p arcane_barrage Fluffy_Pillow 34872.9/68223: 51% mana arcane_charge(4), arcane_power, rune_of_power, redirected_anima(2), gladiators_badge
1:50.967 aoe o arcane_explosion Fluffy_Pillow 39374.3/68223: 58% mana arcane_power, rune_of_power, redirected_anima(2), gladiators_badge
1:52.268 aoe o arcane_explosion Fluffy_Pillow 38649.4/68223: 57% mana arcane_charge, arcane_power, rune_of_power, redirected_anima(2), gladiators_badge
1:53.568 aoe o arcane_explosion Fluffy_Pillow 38161.5/68651: 56% mana arcane_charge(2), arcane_power, redirected_anima(3), gladiators_badge
1:54.868 aoe o arcane_explosion Fluffy_Pillow 37446.4/68651: 55% mana arcane_charge(3), arcane_power, redirected_anima(3), gladiators_badge
1:56.166 aoe l rune_of_power Fluffy_Pillow 36728.6/68651: 54% mana arcane_charge(4), redirected_anima(3)
1:57.466 aoe p arcane_barrage Fluffy_Pillow 38513.5/68651: 56% mana arcane_charge(4), rune_of_power, redirected_anima(3)
1:58.764 aoe o arcane_explosion Fluffy_Pillow 43041.8/68651: 63% mana rune_of_power, redirected_anima(3)
2:00.064 aoe o arcane_explosion Fluffy_Pillow 39826.7/68651: 58% mana arcane_charge, rune_of_power, redirected_anima(3)
2:01.363 aoe o arcane_explosion Fluffy_Pillow 36381.7/68223: 53% mana arcane_charge(2), clearcasting, rune_of_power, redirected_anima(2)
2:02.662 aoe o arcane_explosion Fluffy_Pillow 38154.1/68223: 56% mana arcane_charge(3), rune_of_power, crimson_chorus, redirected_anima(2)
2:03.963 aoe p arcane_barrage Fluffy_Pillow 34929.3/68223: 51% mana arcane_charge(4), rune_of_power, crimson_chorus, redirected_anima(2)
2:05.262 aoe m arcane_orb Fluffy_Pillow 39430.7/68223: 58% mana rune_of_power, crimson_chorus, redirected_anima(2)
2:06.563 aoe p arcane_barrage Fluffy_Pillow 40705.8/68223: 60% mana arcane_charge(4), rune_of_power, crimson_chorus, redirected_anima(2)
2:07.862 aoe o arcane_explosion Fluffy_Pillow 44923.2/67794: 66% mana rune_of_power, crimson_chorus, redirected_anima
2:09.161 aoe o arcane_explosion Fluffy_Pillow 41684.5/67794: 61% mana arcane_charge, rune_of_power, crimson_chorus, redirected_anima
2:10.460 aoe n shifting_power Fluffy_Pillow 38445.8/67794: 57% mana arcane_charge(2), clearcasting, crimson_chorus, redirected_anima
2:14.214 aoe o arcane_explosion Fluffy_Pillow 42592.2/70366: 61% mana arcane_charge(2), clearcasting, crimson_chorus(2), redirected_anima(7)
2:15.514 aoe o arcane_explosion Fluffy_Pillow 44421.7/70366: 63% mana arcane_charge(3), crimson_chorus(2), redirected_anima(7)
2:16.813 aoe p arcane_barrage Fluffy_Pillow 41249.8/70366: 59% mana arcane_charge(4), crimson_chorus(2), redirected_anima(7)
2:18.113 shared_cds r use_mana_gem NightFae_Niya 45894.0/70366: 65% mana crimson_chorus(2), redirected_anima(7)
2:18.113 aoe m arcane_orb Fluffy_Pillow 52930.6/70366: 75% mana crimson_chorus(2), redirected_anima(7)
2:19.413 aoe p arcane_barrage Fluffy_Pillow 54260.1/70366: 77% mana arcane_charge(4), crimson_chorus(2), redirected_anima(7)
2:20.712 aoe o arcane_explosion Fluffy_Pillow 58902.8/70366: 84% mana crimson_chorus(2), redirected_anima(7)
2:22.012 aoe o arcane_explosion Fluffy_Pillow 55732.3/70366: 79% mana arcane_charge, crimson_chorus(3), redirected_anima(7)
2:23.311 aoe o arcane_explosion Fluffy_Pillow 52240.3/69937: 75% mana arcane_charge(2), crimson_chorus(3), redirected_anima(6)
2:24.611 aoe o arcane_explosion Fluffy_Pillow 49058.6/69937: 70% mana arcane_charge(3), crimson_chorus(3), redirected_anima(6)
2:25.909 aoe p arcane_barrage Fluffy_Pillow 45874.2/69937: 66% mana arcane_charge(4), clearcasting, crimson_chorus(3), redirected_anima(6)
2:27.210 aoe o arcane_explosion Fluffy_Pillow 50491.5/69937: 72% mana clearcasting, crimson_chorus(3), redirected_anima(6)
2:28.509 aoe o arcane_explosion Fluffy_Pillow 52308.4/69937: 75% mana arcane_charge, crimson_chorus(3), redirected_anima(6)
2:29.808 aoe j touch_of_the_magi Fluffy_Pillow 49125.4/69937: 70% mana arcane_charge(2), clearcasting, crimson_chorus(3), redirected_anima(6)
2:31.108 aoe l rune_of_power Fluffy_Pillow 48443.8/69937: 69% mana arcane_charge(4), clearcasting, crimson_chorus(3), redirected_anima(6)
2:32.407 aoe p arcane_barrage Fluffy_Pillow 50260.7/69937: 72% mana arcane_charge(4), clearcasting, rune_of_power, redirected_anima(6)
2:33.706 aoe o arcane_explosion Fluffy_Pillow 55211.4/70366: 78% mana clearcasting, rune_of_power, redirected_anima(7)
2:35.004 aoe o arcane_explosion Fluffy_Pillow 57038.1/70366: 81% mana arcane_charge, rune_of_power, redirected_anima(7)
2:36.304 aoe o arcane_explosion Fluffy_Pillow 53867.7/70366: 77% mana arcane_charge(2), rune_of_power, redirected_anima(7)
2:37.603 aoe o arcane_explosion Fluffy_Pillow 50695.8/70366: 72% mana arcane_charge(3), rune_of_power, redirected_anima(7)
2:38.903 aoe p arcane_barrage Fluffy_Pillow 47525.3/70366: 68% mana arcane_charge(4), rune_of_power, redirected_anima(7)
2:40.204 aoe m arcane_orb Fluffy_Pillow 52170.8/70366: 74% mana rune_of_power, redirected_anima(7)
2:41.505 aoe p arcane_barrage Fluffy_Pillow 51546.6/67794: 76% mana arcane_charge(4), rune_of_power, redirected_anima
2:42.804 aoe o arcane_explosion Fluffy_Pillow 56019.6/67794: 83% mana rune_of_power, redirected_anima
2:44.103 aoe o arcane_explosion Fluffy_Pillow 52780.9/67794: 78% mana arcane_charge, rune_of_power, redirected_anima
2:45.402 aoe o arcane_explosion Fluffy_Pillow 49542.2/67794: 73% mana arcane_charge(2), redirected_anima
2:46.702 aoe o arcane_explosion Fluffy_Pillow 46304.9/67794: 68% mana arcane_charge(3), redirected_anima
2:48.001 aoe p arcane_barrage Fluffy_Pillow 43066.2/67794: 64% mana arcane_charge(4), clearcasting, redirected_anima
2:49.301 aoe o arcane_explosion Fluffy_Pillow 47540.6/67794: 70% mana clearcasting, redirected_anima
2:50.601 aoe o arcane_explosion Fluffy_Pillow 49303.2/67794: 73% mana arcane_charge, redirected_anima
2:51.899 aoe o arcane_explosion Fluffy_Pillow 46063.2/67794: 68% mana arcane_charge(2), redirected_anima
2:53.198 aoe o arcane_explosion Fluffy_Pillow 42824.5/67794: 63% mana arcane_charge(3), redirected_anima
2:54.497 aoe p arcane_barrage Fluffy_Pillow 39585.8/67794: 58% mana arcane_charge(4), redirected_anima
2:55.797 aoe n shifting_power Fluffy_Pillow 44060.2/67794: 65% mana redirected_anima
2:59.462 aoe m arcane_orb Fluffy_Pillow 48294.4/70366: 69% mana redirected_anima(7)
3:00.763 aoe p arcane_barrage Fluffy_Pillow 49625.3/70366: 71% mana arcane_charge(4), redirected_anima(7)
3:02.063 aoe o arcane_explosion Fluffy_Pillow 54269.4/70366: 77% mana redirected_anima(7)
3:03.361 aoe o arcane_explosion Fluffy_Pillow 50784.9/69937: 73% mana arcane_charge, crimson_chorus, redirected_anima(6)
3:04.659 aoe o arcane_explosion Fluffy_Pillow 47600.5/69937: 68% mana arcane_charge(2), crimson_chorus, redirected_anima(6)
3:05.957 aoe o arcane_explosion Fluffy_Pillow 44416.1/69937: 64% mana arcane_charge(3), crimson_chorus, redirected_anima(6)
3:07.259 aoe p arcane_barrage Fluffy_Pillow 41237.2/69937: 59% mana arcane_charge(4), crimson_chorus, redirected_anima(6)
3:08.558 aoe o arcane_explosion Fluffy_Pillow 45851.7/69937: 66% mana crimson_chorus, redirected_anima(6)
3:09.858 aoe o arcane_explosion Fluffy_Pillow 42670.0/69937: 61% mana arcane_charge, crimson_chorus, redirected_anima(6)
3:11.159 aoe o arcane_explosion Fluffy_Pillow 39731.8/70366: 56% mana arcane_charge(2), crimson_chorus, redirected_anima(7)
3:12.458 aoe o arcane_explosion Fluffy_Pillow 36559.9/70366: 52% mana arcane_charge(3), crimson_chorus(2), redirected_anima(7)
3:13.758 aoe p arcane_barrage Fluffy_Pillow 33389.4/70366: 47% mana arcane_charge(4), clearcasting, crimson_chorus(2), redirected_anima(7)
3:15.058 aoe o arcane_explosion Fluffy_Pillow 38033.5/70366: 54% mana clearcasting, crimson_chorus(2), redirected_anima(7)
3:16.357 aoe j touch_of_the_magi Fluffy_Pillow 39861.6/70366: 57% mana arcane_charge, crimson_chorus(2), redirected_anima(7)
3:17.656 aoe k arcane_power Fluffy_Pillow 39189.7/70366: 56% mana arcane_charge(4), crimson_chorus(2), redirected_anima(7)
3:17.656 shared_cds s use_items Fluffy_Pillow 39189.7/70366: 56% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), redirected_anima(7)
3:17.656 shared_cds v berserking Fluffy_Pillow 39189.7/70366: 56% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), redirected_anima(7), gladiators_badge
3:17.656 aoe p arcane_barrage Fluffy_Pillow 39189.7/70366: 56% mana berserking, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), redirected_anima(7), gladiators_badge
3:18.838 aoe o arcane_explosion Fluffy_Pillow 43933.8/70794: 62% mana berserking, arcane_power, rune_of_power, crimson_chorus(2), redirected_anima(8), gladiators_badge
3:20.020 aoe o arcane_explosion Fluffy_Pillow 43107.4/70794: 61% mana berserking, arcane_charge, arcane_power, rune_of_power, crimson_chorus(2), redirected_anima(8), gladiators_badge
3:21.202 aoe o arcane_explosion Fluffy_Pillow 42280.9/70794: 60% mana berserking, arcane_charge(2), arcane_power, rune_of_power, crimson_chorus(2), redirected_anima(8), gladiators_badge
3:22.384 aoe o arcane_explosion Fluffy_Pillow 41454.5/70794: 59% mana berserking, arcane_charge(3), arcane_power, rune_of_power, crimson_chorus(3), redirected_anima(8), gladiators_badge
3:23.566 aoe p arcane_barrage Fluffy_Pillow 40628.1/70794: 57% mana berserking, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(3), redirected_anima(8), gladiators_badge
3:24.749 aoe m arcane_orb Fluffy_Pillow 45134.9/70794: 64% mana berserking, arcane_power, rune_of_power, crimson_chorus(3), redirected_anima(8), gladiators_badge
3:25.932 aoe p arcane_barrage Fluffy_Pillow 44868.7/68223: 66% mana berserking, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(3), redirected_anima(2), gladiators_badge
3:27.114 aoe o arcane_explosion Fluffy_Pillow 49210.4/68223: 72% mana berserking, arcane_power, rune_of_power, crimson_chorus(3), redirected_anima(2), gladiators_badge
3:28.297 aoe o arcane_explosion Fluffy_Pillow 48324.5/68223: 71% mana berserking, arcane_charge, arcane_power, rune_of_power, crimson_chorus(3), redirected_anima(2), gladiators_badge
3:29.478 aoe o arcane_explosion Fluffy_Pillow 47436.0/68223: 70% mana berserking, arcane_charge(2), arcane_power, rune_of_power, crimson_chorus(3), redirected_anima(2), gladiators_badge
3:30.659 aoe o arcane_explosion Fluffy_Pillow 46547.4/68223: 68% mana arcane_charge(3), arcane_power, crimson_chorus(3), redirected_anima(2), gladiators_badge
3:31.960 aoe l rune_of_power Fluffy_Pillow 45822.5/68223: 67% mana arcane_charge(4), arcane_power, crimson_chorus(3), redirected_anima(2), gladiators_badge
3:33.260 aoe p arcane_barrage Fluffy_Pillow 47596.3/68223: 70% mana arcane_charge(4), rune_of_power, redirected_anima(2)
3:34.559 aoe o arcane_explosion Fluffy_Pillow 52097.7/68223: 76% mana rune_of_power, redirected_anima(2)
3:35.860 aoe o arcane_explosion Fluffy_Pillow 48872.8/68223: 72% mana arcane_charge, rune_of_power, redirected_anima(2)
3:37.159 aoe o arcane_explosion Fluffy_Pillow 45645.3/68223: 67% mana arcane_charge(2), clearcasting, rune_of_power, redirected_anima(2)
3:38.460 aoe o arcane_explosion Fluffy_Pillow 47420.4/68223: 70% mana arcane_charge(3), rune_of_power, redirected_anima(2)
3:39.759 aoe p arcane_barrage Fluffy_Pillow 44192.9/68223: 65% mana arcane_charge(4), rune_of_power, redirected_anima(2)
3:41.057 aoe o arcane_explosion Fluffy_Pillow 48386.9/67794: 71% mana rune_of_power, redirected_anima
3:42.356 aoe o arcane_explosion Fluffy_Pillow 45148.2/67794: 67% mana arcane_charge, clearcasting, rune_of_power, redirected_anima
3:43.657 aoe o arcane_explosion Fluffy_Pillow 46912.2/67794: 69% mana arcane_charge(2), rune_of_power, redirected_anima
3:44.956 aoe o arcane_explosion Fluffy_Pillow 43673.5/67794: 64% mana arcane_charge(3), rune_of_power, redirected_anima
3:46.254 aoe n shifting_power Fluffy_Pillow 40433.5/67794: 60% mana arcane_charge(4), redirected_anima
3:50.012 aoe p arcane_barrage Fluffy_Pillow 44661.0/70366: 63% mana arcane_charge(4), redirected_anima(7)
3:51.310 aoe m arcane_orb Fluffy_Pillow 49302.3/70366: 70% mana redirected_anima(7)
3:52.611 aoe p arcane_barrage Fluffy_Pillow 50633.2/70366: 72% mana arcane_charge(4), redirected_anima(7)
3:53.912 aoe o arcane_explosion Fluffy_Pillow 55278.8/70366: 79% mana redirected_anima(7)
3:55.212 aoe o arcane_explosion Fluffy_Pillow 52108.3/70366: 74% mana arcane_charge, redirected_anima(7)
3:56.512 aoe o arcane_explosion Fluffy_Pillow 48937.8/70366: 70% mana arcane_charge(2), redirected_anima(7)
3:57.810 aoe o arcane_explosion Fluffy_Pillow 45764.5/70366: 65% mana arcane_charge(3), redirected_anima(7)
3:59.111 aoe p arcane_barrage Fluffy_Pillow 42595.4/70366: 61% mana arcane_charge(4), redirected_anima(7)
4:00.411 aoe o arcane_explosion Fluffy_Pillow 47239.5/70366: 67% mana redirected_anima(7)
4:01.712 shared_cds u time_warp Fluffy_Pillow 44070.4/70366: 63% mana arcane_charge, redirected_anima(7)
4:01.712 aoe o arcane_explosion Fluffy_Pillow 42070.4/70366: 60% mana arcane_charge, temporal_warp, redirected_anima(7)
4:02.714 aoe o arcane_explosion Fluffy_Pillow 38480.6/70366: 55% mana arcane_charge(2), temporal_warp, redirected_anima(7)
4:03.714 aoe o arcane_explosion Fluffy_Pillow 34887.9/70366: 50% mana arcane_charge(3), temporal_warp, crimson_chorus, redirected_anima(7)
4:04.713 aoe p arcane_barrage Fluffy_Pillow 31293.8/70366: 44% mana arcane_charge(4), temporal_warp, crimson_chorus, redirected_anima(7)
4:05.714 aoe j touch_of_the_magi Fluffy_Pillow 35517.1/70366: 50% mana temporal_warp, crimson_chorus, redirected_anima(7)
4:06.715 aoe l rune_of_power Fluffy_Pillow 34425.9/70366: 49% mana arcane_charge(4), temporal_warp, crimson_chorus, redirected_anima(7)
4:07.715 aoe p arcane_barrage Fluffy_Pillow 35833.2/70366: 51% mana arcane_charge(4), rune_of_power, temporal_warp, crimson_chorus, redirected_anima(7)
4:08.715 aoe o arcane_explosion Fluffy_Pillow 40055.1/70366: 57% mana rune_of_power, temporal_warp, crimson_chorus, redirected_anima(7)
4:09.716 aoe o arcane_explosion Fluffy_Pillow 36463.8/70366: 52% mana arcane_charge, rune_of_power, temporal_warp, crimson_chorus, redirected_anima(7)
4:10.718 aoe o arcane_explosion Fluffy_Pillow 32874.0/70366: 47% mana arcane_charge(2), clearcasting, rune_of_power, temporal_warp, crimson_chorus, redirected_anima(7)
4:11.718 aoe o arcane_explosion Fluffy_Pillow 34281.3/70366: 49% mana arcane_charge(3), rune_of_power, temporal_warp, crimson_chorus, redirected_anima(7)
4:12.718 aoe p arcane_barrage Fluffy_Pillow 30688.6/70366: 44% mana arcane_charge(4), rune_of_power, temporal_warp, crimson_chorus(2), redirected_anima(7)
4:13.718 aoe m arcane_orb Fluffy_Pillow 34910.5/70366: 50% mana rune_of_power, temporal_warp, crimson_chorus(2), redirected_anima(7)
4:14.718 aoe p arcane_barrage Fluffy_Pillow 36036.0/70794: 51% mana arcane_charge(4), rune_of_power, temporal_warp, crimson_chorus(2), redirected_anima(8)
4:15.719 aoe o arcane_explosion Fluffy_Pillow 40285.1/70794: 57% mana rune_of_power, temporal_warp, crimson_chorus(2), redirected_anima(8)
4:16.721 aoe o arcane_explosion Fluffy_Pillow 35370.6/68223: 52% mana arcane_charge, rune_of_power, temporal_warp, crimson_chorus(2), redirected_anima(2)
4:17.720 aoe o arcane_explosion Fluffy_Pillow 31733.7/68223: 47% mana arcane_charge(2), rune_of_power, temporal_warp, crimson_chorus(2), redirected_anima(2)
4:18.720 shared_cds r use_mana_gem NightFae_Niya 28098.2/68223: 41% mana arcane_charge(3), clearcasting, rune_of_power, temporal_warp, crimson_chorus(2), redirected_anima(2)
4:18.720 aoe o arcane_explosion Fluffy_Pillow 34920.5/68223: 51% mana arcane_charge(3), clearcasting, rune_of_power, temporal_warp, crimson_chorus(2), redirected_anima(2)
4:19.719 aoe p arcane_barrage Fluffy_Pillow 36055.6/67794: 53% mana arcane_charge(4), temporal_warp, crimson_chorus(2), redirected_anima
4:20.720 aoe o arcane_explosion Fluffy_Pillow 40124.6/67794: 59% mana temporal_warp, crimson_chorus(2), redirected_anima
4:21.720 aoe o arcane_explosion Fluffy_Pillow 36480.5/67794: 54% mana arcane_charge, temporal_warp, crimson_chorus(2), redirected_anima
4:22.718 aoe o arcane_explosion Fluffy_Pillow 32833.7/67794: 48% mana arcane_charge(2), clearcasting, temporal_warp, crimson_chorus(3), redirected_anima
4:23.720 aoe o arcane_explosion Fluffy_Pillow 34192.3/67794: 50% mana arcane_charge(3), temporal_warp, crimson_chorus(3), redirected_anima
4:24.720 aoe p arcane_barrage Fluffy_Pillow 30548.2/67794: 45% mana arcane_charge(4), temporal_warp, crimson_chorus(3), redirected_anima
4:25.720 aoe o arcane_explosion Fluffy_Pillow 34615.8/67794: 51% mana temporal_warp, crimson_chorus(3), redirected_anima
4:26.721 aoe o arcane_explosion Fluffy_Pillow 30973.1/67794: 46% mana arcane_charge, clearcasting, temporal_warp, crimson_chorus(3), redirected_anima
4:27.721 aoe o arcane_explosion Fluffy_Pillow 32329.0/67794: 48% mana arcane_charge(2), temporal_warp, crimson_chorus(3), redirected_anima
4:28.720 aoe o arcane_explosion Fluffy_Pillow 28683.5/67794: 42% mana arcane_charge(3), temporal_warp, crimson_chorus(3), redirected_anima
4:29.720 aoe p arcane_barrage Fluffy_Pillow 25039.4/67794: 37% mana arcane_charge(4), temporal_warp, crimson_chorus(3), redirected_anima
4:30.719 aoe o arcane_explosion Fluffy_Pillow 29105.7/67794: 43% mana temporal_warp, crimson_chorus(3), redirected_anima
4:31.720 aoe n shifting_power Fluffy_Pillow 25462.9/67794: 38% mana arcane_charge, temporal_warp, crimson_chorus(3), redirected_anima
4:34.473 aoe o arcane_explosion Fluffy_Pillow 27708.2/70366: 39% mana arcane_charge, temporal_warp, redirected_anima(7)
4:35.475 aoe o arcane_explosion Fluffy_Pillow 24118.4/70366: 34% mana arcane_charge(2), temporal_warp, redirected_anima(7)
4:36.476 aoe o arcane_explosion Fluffy_Pillow 20527.1/70366: 29% mana arcane_charge(3), temporal_warp, redirected_anima(7)
4:37.475 aoe p arcane_barrage Fluffy_Pillow 16933.0/70366: 24% mana arcane_charge(4), temporal_warp, redirected_anima(7)
4:38.475 aoe m arcane_orb Fluffy_Pillow 21154.9/70366: 30% mana temporal_warp, redirected_anima(7)
4:39.474 aoe p arcane_barrage Fluffy_Pillow 22060.9/70366: 31% mana arcane_charge(4), temporal_warp, redirected_anima(7)
4:40.474 aoe o arcane_explosion Fluffy_Pillow 26282.8/70366: 37% mana temporal_warp, redirected_anima(7)
4:41.474 aoe o arcane_explosion Fluffy_Pillow 22690.1/70366: 32% mana arcane_charge, clearcasting, temporal_warp, redirected_anima(7)
4:42.474 aoe o arcane_explosion Fluffy_Pillow 24097.4/70366: 34% mana arcane_charge(2), redirected_anima(7)
4:43.773 aoe o arcane_explosion Fluffy_Pillow 20925.5/70366: 30% mana arcane_charge(3), redirected_anima(7)
4:45.072 aoe p arcane_barrage Fluffy_Pillow 17645.5/69937: 25% mana arcane_charge(4), redirected_anima(6)
4:46.372 aoe o arcane_explosion Fluffy_Pillow 22261.3/69937: 32% mana redirected_anima(6)
4:47.671 aoe o arcane_explosion Fluffy_Pillow 19078.3/69937: 27% mana arcane_charge, redirected_anima(6)
4:48.972 aoe o arcane_explosion Fluffy_Pillow 15898.1/69937: 23% mana arcane_charge(2), redirected_anima(6)
4:50.270 aoe o arcane_explosion Fluffy_Pillow 12713.6/69937: 18% mana arcane_charge(3), redirected_anima(6)
4:51.570 aoe p arcane_barrage Fluffy_Pillow 9532.0/69937: 14% mana arcane_charge(4), redirected_anima(6)
4:52.869 aoe j touch_of_the_magi Fluffy_Pillow 14146.5/69937: 20% mana redirected_anima(6)
4:54.167 aoe k arcane_power Fluffy_Pillow 13462.0/69937: 19% mana arcane_charge(4), redirected_anima(6)
4:54.167 shared_cds s use_items Fluffy_Pillow 13462.0/69937: 19% mana arcane_charge(4), arcane_power, rune_of_power, redirected_anima(6)
4:54.167 aoe p arcane_barrage Fluffy_Pillow 13462.0/69937: 19% mana arcane_charge(4), arcane_power, rune_of_power, redirected_anima(6), gladiators_badge
4:55.467 aoe o arcane_explosion Fluffy_Pillow 18188.7/70366: 26% mana arcane_power, rune_of_power, redirected_anima(7), gladiators_badge
4:56.769 aoe o arcane_explosion Fluffy_Pillow 17521.0/70366: 25% mana arcane_charge, arcane_power, rune_of_power, redirected_anima(7), gladiators_badge
4:58.069 aoe o arcane_explosion Fluffy_Pillow 16850.5/70366: 24% mana arcane_charge(2), arcane_power, rune_of_power, redirected_anima(7), gladiators_badge
4:59.368 aoe o arcane_explosion Fluffy_Pillow 16178.6/70366: 23% mana arcane_charge(3), arcane_power, rune_of_power, redirected_anima(7), gladiators_badge
5:00.667 aoe p arcane_barrage Fluffy_Pillow 15506.7/70366: 22% mana arcane_charge(4), arcane_power, rune_of_power, redirected_anima(7), gladiators_badge
5:01.965 shared_cds t potion Fluffy_Pillow 19411.7/67794: 29% mana arcane_power, rune_of_power, redirected_anima, gladiators_badge
5:01.965 aoe m arcane_orb Fluffy_Pillow 19411.7/67794: 29% mana arcane_power, rune_of_power, redirected_anima, potion_of_deathly_fixation, gladiators_badge
5:03.263 aoe p arcane_barrage Fluffy_Pillow 20921.7/67794: 31% mana arcane_charge(4), arcane_power, rune_of_power, redirected_anima, potion_of_deathly_fixation, gladiators_badge
5:04.564 aoe o arcane_explosion Fluffy_Pillow 25397.5/67794: 37% mana arcane_power, rune_of_power, crimson_chorus, redirected_anima, potion_of_deathly_fixation, gladiators_badge
5:05.863 aoe o arcane_explosion Fluffy_Pillow 24658.7/67794: 36% mana arcane_charge, arcane_power, rune_of_power, crimson_chorus, redirected_anima, potion_of_deathly_fixation, gladiators_badge
5:07.163 aoe o arcane_explosion Fluffy_Pillow 23921.4/67794: 35% mana arcane_charge(2), arcane_power, crimson_chorus, redirected_anima, potion_of_deathly_fixation, gladiators_badge
5:08.463 aoe o arcane_explosion Fluffy_Pillow 23184.1/67794: 34% mana arcane_charge(3), arcane_power, crimson_chorus, redirected_anima, potion_of_deathly_fixation, gladiators_badge
5:09.763 aoe l rune_of_power Fluffy_Pillow 22446.7/67794: 33% mana arcane_charge(4), crimson_chorus, redirected_anima, potion_of_deathly_fixation
5:11.063 aoe p arcane_barrage Fluffy_Pillow 24209.4/67794: 36% mana arcane_charge(4), rune_of_power, crimson_chorus, redirected_anima, potion_of_deathly_fixation
5:12.364 aoe o arcane_explosion Fluffy_Pillow 28685.1/67794: 42% mana rune_of_power, crimson_chorus, redirected_anima, potion_of_deathly_fixation
5:13.663 aoe o arcane_explosion Fluffy_Pillow 25446.4/67794: 38% mana arcane_charge, rune_of_power, crimson_chorus, redirected_anima, potion_of_deathly_fixation
5:14.963 aoe o arcane_explosion Fluffy_Pillow 22209.1/67794: 33% mana arcane_charge(2), rune_of_power, crimson_chorus(2), redirected_anima, potion_of_deathly_fixation
5:16.262 aoe o arcane_explosion Fluffy_Pillow 18970.4/67794: 28% mana arcane_charge(3), rune_of_power, crimson_chorus(2), redirected_anima, potion_of_deathly_fixation
5:17.562 aoe p arcane_barrage Fluffy_Pillow 15733.0/67794: 23% mana arcane_charge(4), rune_of_power, crimson_chorus(2), redirected_anima, potion_of_deathly_fixation
5:18.863 aoe o arcane_explosion Fluffy_Pillow 20208.8/67794: 30% mana rune_of_power, crimson_chorus(2), redirected_anima, potion_of_deathly_fixation
5:20.162 aoe o arcane_explosion Fluffy_Pillow 16970.1/67794: 25% mana arcane_charge, rune_of_power, crimson_chorus(2), redirected_anima, potion_of_deathly_fixation
5:21.462 aoe o arcane_explosion Fluffy_Pillow 13732.8/67794: 20% mana arcane_charge(2), clearcasting, rune_of_power, crimson_chorus(2), redirected_anima, potion_of_deathly_fixation
5:22.760 aoe o arcane_explosion Fluffy_Pillow 15492.7/67794: 23% mana arcane_charge(3), rune_of_power, crimson_chorus(2), redirected_anima, potion_of_deathly_fixation
5:24.058 aoe n shifting_power Fluffy_Pillow 12252.6/67794: 18% mana arcane_charge(4), crimson_chorus(3), redirected_anima, potion_of_deathly_fixation
5:27.856 aoe p arcane_barrage Fluffy_Pillow 15373.3/69937: 22% mana arcane_charge(4), crimson_chorus(3), redirected_anima(6)
5:29.155 aoe m arcane_orb Fluffy_Pillow 19987.8/69937: 29% mana crimson_chorus(3), redirected_anima(6)
5:30.453 aoe p arcane_barrage Fluffy_Pillow 21303.3/69937: 30% mana arcane_charge(4), crimson_chorus(3), redirected_anima(6)
5:31.754 aoe o arcane_explosion Fluffy_Pillow 25920.6/69937: 37% mana crimson_chorus(3), redirected_anima(6)
5:33.055 aoe o arcane_explosion Fluffy_Pillow 22740.4/69937: 33% mana arcane_charge, crimson_chorus(3), redirected_anima(6)
5:34.354 aoe o arcane_explosion Fluffy_Pillow 19557.3/69937: 28% mana arcane_charge(2), redirected_anima(6)
5:35.655 aoe o arcane_explosion Fluffy_Pillow 16377.1/69937: 23% mana arcane_charge(3), redirected_anima(6)
5:36.953 aoe p arcane_barrage Fluffy_Pillow 13192.7/69937: 19% mana arcane_charge(4), redirected_anima(6)
5:38.252 aoe o arcane_explosion Fluffy_Pillow 17807.1/69937: 25% mana redirected_anima(6)
5:39.551 aoe o arcane_explosion Fluffy_Pillow 14624.1/69937: 21% mana arcane_charge, redirected_anima(6)
5:40.850 aoe o arcane_explosion Fluffy_Pillow 11441.0/69937: 16% mana arcane_charge(2), redirected_anima(6)
5:42.150 aoe o arcane_explosion Fluffy_Pillow 8259.4/69937: 12% mana arcane_charge(3), clearcasting, redirected_anima(6)
5:43.448 aoe p arcane_barrage Fluffy_Pillow 10075.0/69937: 14% mana arcane_charge(4), redirected_anima(6)
5:44.748 aoe j touch_of_the_magi Fluffy_Pillow 14690.8/69937: 21% mana redirected_anima(6)
5:46.047 aoe l rune_of_power Fluffy_Pillow 14007.8/69937: 20% mana arcane_charge(4), redirected_anima(6)
5:47.346 aoe p arcane_barrage Fluffy_Pillow 15824.8/69937: 23% mana arcane_charge(4), rune_of_power, redirected_anima(6)
5:48.645 aoe o arcane_explosion Fluffy_Pillow 20439.2/69937: 29% mana rune_of_power, redirected_anima(6)
5:49.947 aoe o arcane_explosion Fluffy_Pillow 17260.4/69937: 25% mana arcane_charge, rune_of_power, redirected_anima(6)

Stats

Level Bonus (60) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 198 1 199 199 0
Agility 306 2 308 308 0
Stamina 414 0 2013 1918 1504
Intellect 450 -3 1767 1588 1066 (46)
Spirit 0 0 0 0 0
Health 40260 38360 0
Mana 67366 67366 0
Spell Power 1767 1588 0
Crit 15.74% 15.74% 376
Haste 15.76% 15.76% 520
Versatility 7.97% 7.97% 319
Mana Regen 1347 1347 0
Mastery 34.73% 34.73% 733
Armor 369 369 369
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 227.00
Local Head Confidant's Favored Cap
ilevel: 226, stats: { 44 Armor, +82 Int, +149 Sta, +44 Haste, +98 Mastery }
Local Neck Noble's Birthstone Pendant
ilevel: 226, stats: { +84 Sta, +52 Crit, +162 Mastery }
Local Shoulders Shawl of the Penitent
ilevel: 233, stats: { 42 Armor, +65 Int, +122 Sta, +33 Crit, +76 Haste }
Local Chest Robes of the Cursed Commando
ilevel: 233, stats: { 61 Armor, +87 Int, +162 Sta, +47 Crit, +100 Haste }, enchant: { +20 Int }
Local Waist Cinch of Infinite Tightness
ilevel: 226, stats: { 33 Armor, +61 Int, +112 Sta, +69 Crit, +36 Vers }
Local Legs Courtier's Costume Trousers
ilevel: 226, stats: { 51 Armor, +82 Int, +149 Sta, +49 Vers, +93 Mastery }
Local Feet Slippers of the Forgotten Heretic
ilevel: 226, stats: { 36 Armor, +61 Int, +112 Sta, +73 Crit, +32 Mastery }
Local Wrists Acolyte's Velvet Bindings
ilevel: 226, stats: { 29 Armor, +46 Int, +84 Sta, +26 Vers, +53 Mastery }, enchant: { +15 Int }
Local Hands Impossibly Oversized Mitts
ilevel: 226, stats: { 33 Armor, +61 Int, +112 Sta, +31 Haste, +74 Mastery }
Local Finger1 Most Regal Signet of Sire Denathrius
ilevel: 233, stats: { +91 Sta, +178 Haste, +48 Mastery }, enchant: { +16 Mastery }
item effects: { equip: Denathrius' Privilege }
Local Finger2 Shadowghast Ring
ilevel: 235, stats: { +94 Sta, +115 Mastery, +115 Vers }, enchant: { +16 Mastery }
item effects: { equip: Temporal Warp }
Local Trinket1 Cabalist's Hymnal
ilevel: 226, stats: { +77 Int }
item effects: { equip: Crimson Chorus }
Local Trinket2 Sinful Aspirant's Badge of Ferocity
ilevel: 207, stats: { +91 Haste }
item effects: { use: Gladiator's Badge }
Local Back Mantle of Manifest Sins
ilevel: 226, stats: { 40 Armor, +84 Sta, +53 Crit, +26 Mastery, +46 StrAgiInt }
Local Main Hand Staff of the Penitent
ilevel: 226, weapon: { 93 - 128, 3.6 }, stats: { +82 Int, +281 Int, +149 Sta, +49 Crit, +93 Vers }, enchant: sinful_revelation

Profile

mage="NightFae_Niya"
source=default
spec=arcane
level=60
race=troll
role=spell
position=back
talents=1031021
talent_override=resonance,if=3>2
covenant=night_fae
soulbind=322721//arcane_prodigy:6//51:6

# Default consumables
potion=deathly_fixation
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=variable,name=prepull_evo,op=reset,default=0
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
actions.precombat+=/variable,name=have_opened,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
actions.precombat+=/variable,name=final_burn,op=set,value=0
actions.precombat+=/variable,name=rs_max_delay,op=reset,default=5
actions.precombat+=/variable,name=ap_max_delay,op=reset,default=10
actions.precombat+=/variable,name=rop_max_delay,op=reset,default=20
actions.precombat+=/variable,name=totm_max_delay,op=reset,default=5
actions.precombat+=/variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
actions.precombat+=/variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
actions.precombat+=/variable,name=barrage_mana_pct,op=reset,default=70
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=reset,default=30
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
actions.precombat+=/variable,name=totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=aoe_totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=am_spam,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
actions.precombat+=/variable,name=am_spam_evo_pct,op=reset,default=15
actions.precombat+=/flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_familiar
actions.precombat+=/arcane_intellect
actions.precombat+=/conjure_mana_gem
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/frostbolt,if=variable.prepull_evo<=0
actions.precombat+=/evocation,if=variable.prepull_evo>0

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/call_action_list,name=shared_cds
actions+=/call_action_list,name=essences
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/call_action_list,name=opener,if=variable.have_opened<=0
actions+=/call_action_list,name=am_spam,if=variable.am_spam=1
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=rotation,if=variable.final_burn=0
actions+=/call_action_list,name=final_burn,if=variable.final_burn=1
actions+=/call_action_list,name=movement

actions.am_spam=cancel_action,if=action.evocation.channeling&mana.pct>=95
actions.am_spam+=/evocation,if=mana.pct<=variable.am_spam_evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/rune_of_power,if=buff.rune_of_power.down&cooldown.arcane_power.remains>0
actions.am_spam+=/touch_of_the_magi,if=(cooldown.arcane_power.remains=0&buff.rune_of_power.down)|prev_gcd.1.rune_of_power
actions.am_spam+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&buff.rune_of_power.down&essence.vision_of_perfection.enabled
actions.am_spam+=/arcane_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.ap_max_delay
actions.am_spam+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=action.arcane_missiles.execute_time&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_barrage,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_missiles,if=buff.clearcasting.react,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/arcane_missiles,if=!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.am_spam+=/arcane_barrage
actions.am_spam+=/arcane_blast

actions.aoe=frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
actions.aoe+=/arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
actions.aoe+=/mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
actions.aoe+=/arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
actions.aoe+=/rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
actions.aoe+=/presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
actions.aoe+=/arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
actions.aoe+=/supernova
actions.aoe+=/arcane_orb,if=buff.arcane_charge.stack=0
actions.aoe+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
actions.aoe+=/arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1

# Prioritize using grisly icicle with ap. Use it with totm otherwise.
actions.cooldowns=frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.cooldowns+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
# Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
# Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
actions.cooldowns+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
# Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
# Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
# Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
actions.cooldowns+=/arcane_power,if=(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
actions.cooldowns+=/rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
# Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
actions.cooldowns+=/presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
# Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.cooldowns+=/presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled

actions.essences=blood_of_the_enemy,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/blood_of_the_enemy,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains>=50&cooldown.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay
actions.essences+=/worldvein_resonance,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/guardian_of_azeroth,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/guardian_of_azeroth,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/concentrated_flame,line_cd=6,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/reaping_flames,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/focused_azerite_beam,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/purifying_blast,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/ripple_in_space,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/the_unbound_force,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/memory_of_lucid_dreams,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down

actions.final_burn=arcane_missiles,if=buff.clearcasting.react,chain=1
actions.final_burn+=/arcane_blast
actions.final_burn+=/arcane_barrage

actions.movement=blink_any,if=movement.distance>=10
actions.movement+=/presence_of_mind
actions.movement+=/arcane_missiles,if=movement.distance<10
actions.movement+=/arcane_orb
actions.movement+=/fire_blast

actions.opener=variable,name=have_opened,op=set,value=1,if=prev_gcd.1.evocation
actions.opener+=/fire_blast,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command_frost.up
actions.opener+=/frost_nova,if=runeforge.grisly_icicle.equipped&mana.pct>95
actions.opener+=/mirrors_of_torment
actions.opener+=/deathborne
actions.opener+=/radiant_spark,if=mana.pct>40
actions.opener+=/cancel_action,if=action.shifting_power.channeling&gcd.remains=0
actions.opener+=/shifting_power,if=soulbind.field_of_blossoms.enabled
actions.opener+=/touch_of_the_magi
actions.opener+=/arcane_power
actions.opener+=/rune_of_power,if=buff.rune_of_power.down
actions.opener+=/presence_of_mind
actions.opener+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.opener+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.opener+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.opener+=/arcane_missiles,if=buff.clearcasting.react,chain=1
actions.opener+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges&(cooldown.arcane_power.remains>10|active_enemies<=2)
actions.opener+=/arcane_blast,if=buff.rune_of_power.up|mana.pct>15
actions.opener+=/evocation,if=buff.rune_of_power.down,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.opener+=/arcane_barrage

actions.rotation=variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
actions.rotation+=/strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
actions.rotation+=/arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
actions.rotation+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.rotation+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.rotation+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
actions.rotation+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
actions.rotation+=/supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.rotation+=/arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
actions.rotation+=/arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_blast
actions.rotation+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.rotation+=/arcane_barrage

actions.shared_cds=use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
actions.shared_cds+=/use_items,if=buff.arcane_power.up
actions.shared_cds+=/potion,if=buff.arcane_power.up
actions.shared_cds+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
actions.shared_cds+=/lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/berserking,if=buff.arcane_power.up
actions.shared_cds+=/blood_fury,if=buff.arcane_power.up
actions.shared_cds+=/fireblood,if=buff.arcane_power.up
actions.shared_cds+=/ancestral_call,if=buff.arcane_power.up

head=confidants_favored_cap,id=183021,bonus_id=1498,ilevel=226
neck=nobles_birthstone_pendant,id=183039,bonus_id=1498,ilevel=226
shoulders=shawl_of_the_penitent,id=183020,bonus_id=1498,ilevel=233
back=mantle_of_manifest_sins,id=183033,bonus_id=1498,ilevel=226
chest=robes_of_the_cursed_commando,id=182998,bonus_id=1498,ilevel=233,enchant=eternal_insight
wrists=acolytes_velvet_bindings,id=183017,bonus_id=1498,ilevel=226,enchant=eternal_intellect
hands=impossibly_oversized_mitts,id=183022,bonus_id=1498,ilevel=226
waist=cinch_of_infinite_tightness,id=183028,bonus_id=1498,ilevel=226
legs=courtiers_costume_trousers,id=183011,bonus_id=1498,ilevel=226
feet=slippers_of_the_forgotten_heretic,id=182979,bonus_id=1498,ilevel=226
finger1=most_regal_signet_of_sire_denathrius,id=183036,bonus_id=1498,ilevel=233,enchant=16mastery
finger2=shadowghast_ring,id=178926,bonus_id=6648/6650/6758/6834/1532,ilevel=235,enchant=16mastery
trinket1=cabalists_hymnal,id=184028,bonus_id=1498,ilevel=226
trinket2=sinful_aspirants_badge_of_ferocity,id=175884,bonus_id=1521,ilevel=207
main_hand=staff_of_the_penitent,id=180000,bonus_id=7187/6652/1524,ilevel=226,enchant=sinful_revelation

# Gear Summary
# gear_ilvl=226.73
# gear_stamina=1504
# gear_intellect=1066
# gear_crit_rating=376
# gear_haste_rating=520
# gear_mastery_rating=733
# gear_versatility_rating=319
# gear_armor=369

Venthyr_Nadjia : 8681 dps, 3725 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
8680.9 8680.9 12.1 / 0.139% 875.6 / 10.1% 3.8
RPS Out RPS In Primary Resource Waiting APM Active Skill
2261.2 2151.8 Mana 0.00% 54.4 100.0% 100%
Talents
Venthyr
Runeforge

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Venthyr_Nadjia 8681
Arcane Barrage 3258 37.5% 60.8 4.94sec 16056 13985 Direct 182.2 4472 9182 5359 18.9%

Stats Details: Arcane Barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 60.81 182.18 0.00 0.00 1.1481 0.0000 976340.32 976340.32 0.00% 13984.88 13984.88
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.15% 147.84 108 188 4471.62 2155 14549 4474.50 4030 4896 660979 660979 0.00%
crit 18.85% 34.34 13 58 9182.37 4309 29099 9187.42 6516 12440 315361 315361 0.00%

Action Details: Arcane Barrage

  • id:44425
  • school:arcane
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.728000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=0 + 72.8%} Arcane damage. For each Arcane Charge, deals {$36032s2=30}% additional damage$?a321526[, grants you {$321526s1=2}% of your maximum mana,][]$?a231564[ and hits {$36032s3=0} additional nearby $Ltarget:targets; for {$s2=40}% of its damage][]. |cFFFFFFFFConsumes all Arcane Charges.|r

Action Priority List

    aoe
    [p]:60.80
  • if_expr:buff.arcane_charge.stack=buff.arcane_charge.max_stack
Arcane Explosion 3883 44.7% 168.8 1.75sec 6895 6032 Direct 506.5 1923 3944 2299 18.6%

Stats Details: Arcane Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 168.83 506.49 0.00 0.00 1.1430 0.0000 1164112.26 1164112.26 0.00% 6032.39 6032.39
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.39% 412.25 319 515 1922.63 1427 3855 1924.23 1828 2041 792546 792546 0.00%
crit 18.61% 94.24 57 135 3943.71 2855 7710 3944.89 3453 4486 371567 371567 0.00%

Action Details: Arcane Explosion

  • id:1449
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.502320
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s2=0 + 50.2%} Arcane damage to all enemies within $A2 yards.$?a137021[ |cFFFFFFFFGenerates {$s1=1} Arcane Charge if any targets are hit.|r][]

Action Priority List

    aoe
    [o]:168.81
  • if_expr:buff.arcane_charge.stack<buff.arcane_charge.max_stack
Arcane Orb 0 (661) 0.0% (7.6%) 13.4 23.00sec 14795 12550

Stats Details: Arcane Orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.40 0.00 0.00 0.00 1.1790 0.0000 0.00 0.00 0.00% 12549.59 12549.59

Action Details: Arcane Orb

  • id:153626
  • school:arcane
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:153626
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r

Action Priority List

    aoe
    [n]:13.40
  • if_expr:buff.arcane_charge.stack=0
    Arcane Orb (_bolt) 661 7.6% 40.1 23.00sec 4941 0 Direct 40.1 4141 8514 4943 18.3%

Stats Details: Arcane Orb Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 40.14 40.14 0.00 0.00 0.0000 0.0000 198308.55 198308.55 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.68% 32.79 21 47 4140.86 2821 7619 4143.13 3527 4763 135723 135723 0.00%
crit 18.32% 7.35 0 17 8513.79 5642 15237 8532.87 0 14950 62586 62586 0.00%

Action Details: Arcane Orb Bolt

  • id:153640
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.092000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:153640
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:{$@spelldesc153626=Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r}
Deathly Fixation 0 (86) 0.0% (1.0%) 18.6 1.33sec 1373 0

Stats Details: Deathly Fixation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.64 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Deathly Fixation

  • id:322253
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:42.90
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322253
  • name:Deathly Fixation
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1.
  • description:Deal {$s1=43} Shadow damage every $t1. Stacks up to 5 times.
    Deathly Eruption 86 1.0% 18.6 1.33sec 1373 0 Direct 18.6 1136 2274 1373 20.9%

Stats Details: Deathly Eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.64 18.64 0.00 0.00 0.0000 0.0000 25598.04 25598.04 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.13% 14.75 7 24 1135.95 1117 1184 1135.83 1117 1184 16754 16754 0.00%
crit 20.87% 3.89 0 11 2273.91 2233 2367 2240.94 0 2367 8844 8844 0.00%

Action Details: Deathly Eruption

  • id:322256
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:984.99
  • base_dd_max:984.99
  • base_dd_mult:1.00

Spelldata

  • id:322256
  • name:Deathly Eruption
  • school:shadow
  • tooltip:
  • description:Deal {$s1=985} Shadow damage.
Eternal Insight 40 0.5% 21.9 13.42sec 550 0 Direct 21.9 464 929 550 18.4%

Stats Details: Eternal Insight

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 21.92 21.92 0.00 0.00 0.0000 0.0000 12054.94 12054.94 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.59% 17.89 8 32 464.31 453 481 464.33 453 478 8305 8305 0.00%
crit 18.41% 4.04 0 12 928.86 907 961 911.25 0 961 3750 3750 0.00%

Action Details: Eternal Insight

  • id:342314
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:400.00
  • base_dd_max:400.00
  • base_dd_mult:1.00

Spelldata

  • id:342314
  • name:Eternal Insight
  • school:shadow
  • tooltip:
  • description:Deals {$s1=400} Shadow damage.
Frostbolt 4 0.0% 0.0 0.00sec 0 0 Direct 1.0 1024 2047 1192 16.7%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 1.00 0.00 0.00 0.0000 0.0000 1194.44 1194.44 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.32% 0.83 0 1 1023.69 1024 1024 852.95 0 1024 853 853 0.00%
crit 16.68% 0.17 0 1 2047.39 2047 2047 341.49 0 2047 341 341 0.00%

Action Details: Frostbolt

  • id:116
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.511000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116
  • name:Frostbolt
  • school:frost
  • tooltip:
  • description:Launches a bolt of frost at the enemy, causing {$228597s1=0} Frost damage and slowing movement speed by {$205708s1=50}% for {$205708d=8 seconds}.
Mirror Image 0 (19) 0.0% (0.2%) 1.0 0.00sec 5756 0

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.
    Frostbolt (mirror_image) 144  / 19 0.2% 117.0 0.99sec 49 49 Direct 117.0 41 83 49 20.0%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 117.00 117.00 0.00 0.00 1.0091 0.0000 5756.40 5756.40 0.00% 48.76 48.76
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.05% 93.66 81 106 40.87 30 51 40.87 40 42 3828 3828 0.00%
crit 19.95% 23.34 11 36 82.61 59 101 82.65 70 94 1929 1929 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:40.00
Mirrors of Torment 0 (86) 0.0% (1.0%) 2.4 152.85sec 10651 9287

Stats Details: Mirrors Of Torment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.42 0.00 0.00 0.00 1.1472 0.0000 0.00 0.00 0.00% 9286.77 9286.77

Action Details: Mirrors Of Torment

  • id:314793
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:314793
  • name:Mirrors of Torment
  • school:shadow
  • tooltip:Attacking, casting a spell or ability, consumes a mirror to inflict Shadow damage and reduce cast and movement speed by {$320035s3=15}%. Your final mirror will instead Root and Silence you for {$317589d=4 seconds}.
  • description:Conjure $n mirrors to torment the enemy for {$d=25 seconds}. Whenever the target attacks, casts a spell, or uses an ability, a mirror is consumed to inflict {$320035s1=0} Shadow damage and their movement and cast speed are slowed by {$320035s3=15}%. This effect cannot be triggered more often than once per {$345977d=6 seconds}. The final mirror will instead inflict {$317589s1=0} Shadow damage to the enemy, Rooting and Silencing them for {$317589d=4 seconds}. Whenever a mirror is consumed $?c1[you gain {$345417s1=4}% mana][]$?c2[your Fire Blast cooldown is reduced by {$s2=4} sec][]$?c3[you gain Brain Freeze][].

Action Priority List

    aoe
    [j]:2.43
  • if_expr:(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
    Agonizing Backlash 41 0.5% 4.8 58.37sec 2608 0 Direct 4.8 2185 4530 2611 18.1%

Stats Details: Agonizing Backlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 4.77 4.77 0.00 0.00 0.0000 0.0000 12427.22 12427.22 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.86% 3.90 0 6 2185.48 1202 3246 2192.79 0 3246 8524 8524 0.00%
crit 18.14% 0.86 0 4 4529.70 2404 6493 2768.14 0 6493 3903 3903 0.00%

Action Details: Agonizing Backlash

  • id:320035
  • school:shadow
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:320035
  • name:Agonizing Backlash
  • school:shadow
  • tooltip:Movement speed and cast speed slowed by {$s3=15}%.
  • description:{$@spelldesc314793=Conjure $n mirrors to torment the enemy for {$d=25 seconds}. Whenever the target attacks, casts a spell, or uses an ability, a mirror is consumed to inflict {$320035s1=0} Shadow damage and their movement and cast speed are slowed by {$320035s3=15}%. This effect cannot be triggered more often than once per {$345977d=6 seconds}. The final mirror will instead inflict {$317589s1=0} Shadow damage to the enemy, Rooting and Silencing them for {$317589d=4 seconds}. Whenever a mirror is consumed $?c1[you gain {$345417s1=4}% mana][]$?c2[your Fire Blast cooldown is reduced by {$s2=4} sec][]$?c3[you gain Brain Freeze][].}
    Tormenting Backlash 45 0.5% 2.3 152.98sec 5800 0 Direct 2.3 4809 9867 5802 19.6%

Stats Details: Tormenting Backlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.31 2.31 0.00 0.00 0.0000 0.0000 13380.70 13380.70 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.38% 1.85 0 3 4809.47 4235 5506 4685.46 0 5506 8917 8917 0.00%
crit 19.62% 0.45 0 3 9866.84 8470 11011 3865.75 0 11011 4464 4464 0.00%

Action Details: Tormenting Backlash

  • id:317589
  • school:shadow
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.510000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:317589
  • name:Tormenting Backlash
  • school:shadow
  • tooltip:Rooted and Silenced.
  • description:{$@spelldesc314793=Conjure $n mirrors to torment the enemy for {$d=25 seconds}. Whenever the target attacks, casts a spell, or uses an ability, a mirror is consumed to inflict {$320035s1=0} Shadow damage and their movement and cast speed are slowed by {$320035s3=15}%. This effect cannot be triggered more often than once per {$345977d=6 seconds}. The final mirror will instead inflict {$317589s1=0} Shadow damage to the enemy, Rooting and Silencing them for {$317589d=4 seconds}. Whenever a mirror is consumed $?c1[you gain {$345417s1=4}% mana][]$?c2[your Fire Blast cooldown is reduced by {$s2=4} sec][]$?c3[you gain Brain Freeze][].}
Touch of the Magi 0 (643) 0.0% (7.4%) 6.2 51.16sec 30842 26738

Stats Details: Touch Of The Magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.25 0.00 0.00 0.00 1.1536 0.0000 0.00 0.00 0.00% 26737.80 26737.80

Action Details: Touch Of The Magi

  • id:321507
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:4.0

Spelldata

  • id:321507
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]

Action Priority List

    aoe
    [k]:6.27
  • if_expr:buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
    Touch of the Magi (_explosion) 643 7.4% 6.2 51.05sec 30842 0 Direct 18.7 10305 0 10305 0.0%

Stats Details: Touch Of The Magi Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.25 18.71 0.00 0.00 0.0000 0.0000 192699.35 192699.35 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 18.71 15 21 10305.37 236 47644 10287.69 7517 13185 192699 192699 0.00%

Action Details: Touch Of The Magi Explosion

  • id:210833
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:10864.87
  • base_dd_max:10864.87
  • base_dd_mult:1.00

Spelldata

  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc321507=Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]}
Simple Action Stats Execute Interval
Venthyr_Nadjia
Arcane Power 2.9 125.77sec

Stats Details: Arcane Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.89 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Power

  • id:12042
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].

Action Priority List

    aoe
    [l]:2.89
  • if_expr:((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
Berserking 1.9 251.42sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.89 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    shared_cds
    [v]:1.89
  • if_expr:buff.arcane_power.up
Conjure Mana Gem 1.0 0.00sec

Stats Details: Conjure Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Conjure Mana Gem

  • id:759
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:9000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:759
  • name:Conjure Mana Gem
  • school:arcane
  • tooltip:
  • description:Conjures a Mana Gem that can be used to instantly restore {$5405s1=10}% mana, and holds up to {$s2=3} charges. $@spellname118812 {$@spelldesc118812=Conjured items disappear if logged out for more than 15 minutes.}
Evocation 1.1 225.57sec

Stats Details: Evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.14 0.00 6.77 0.00 4.0063 0.6740 0.00 0.00 0.00% 0.00 0.00

Action Details: Evocation

  • id:12051
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Venthyr_Nadjia
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.

Action Priority List

    aoe
    [q]:1.14
  • interrupt_if_expr:mana.pct>=85
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Venthyr_Nadjia
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Venthyr_Nadjia
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Deathly Fixation (potion) 1.0 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307497
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    shared_cds
    [t]:1.00
  • if_expr:buff.arcane_power.up
Rune of Power 6.1 50.06sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.12 0.00 0.00 0.00 1.1512 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    aoe
    [m]:6.13
  • if_expr:buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Time Warp 1.5 300.66sec

Stats Details: Time Warp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.49 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Time Warp

  • id:80353
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:2000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:80353
  • name:Time Warp
  • school:arcane
  • tooltip:Haste increased by $w1%. $?$W4>0[Time rate increased by $w4%.][]$?$W3=1[ When the effect ends, you die.][]
  • description:Warp the flow of time, increasing haste by {$s1=30}% $?a320919[and time rate by {$s4=0}% ][]for all party and raid members for {$d=40 seconds}. Allies will be unable to benefit from Bloodlust, Heroism, or Time Warp again for {$57724d=600 seconds}.$?a320920[ When the effect ends, you die.][]

Action Priority List

    shared_cds
    [u]:1.49
  • if_expr:runeforge.temporal_warp.equipped&buff.exhaustion.up
Replenish Mana (use_mana_gem) 2.8 124.48sec

Stats Details: Use Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.76 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Use Mana Gem

  • id:5405
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Venthyr_Nadjia
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5405
  • name:Replenish Mana
  • school:physical
  • tooltip:Restoring $w2 mana every $t1 sec.
  • description:Restores {$s1=10}% mana.

Action Priority List

    shared_cds
    [r]:2.77
  • if_expr:(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Arcane Charge 61.6 167.1 4.9sec 1.3sec 3.6sec 73.98% 0.00% 1.3 (2.2) 0.0

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.8s / 13.4s
  • trigger_min/max:0.0s / 8.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 9.8s

Stack Uptimes

  • arcane_charge_1:19.02%
  • arcane_charge_2:17.39%
  • arcane_charge_3:16.41%
  • arcane_charge_4:21.15%

Spelldata

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 2.9 0.0 125.8sec 125.8sec 14.7sec 14.18% 0.00% 0.0 (0.0) 2.8

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:121.1s / 130.8s
  • trigger_min/max:121.1s / 130.8s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 15.0s

Stack Uptimes

  • arcane_power_1:14.18%

Spelldata

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Berserking 1.9 0.0 251.5sec 251.5sec 11.7sec 7.35% 6.51% 0.0 (0.0) 1.8

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:249.0s / 260.1s
  • trigger_min/max:249.0s / 260.1s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s

Stack Uptimes

  • berserking_1:7.35%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.51% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.51%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Clearcasting 26.8 0.2 10.9sec 10.8sec 1.8sec 16.10% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_clearcasting
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • clearcasting_1:15.93%
  • clearcasting_2:0.17%
  • clearcasting_3:0.04%

Spelldata

  • id:263725
  • name:Clearcasting
  • tooltip:Your next Arcane Missiles or Arcane Explosion costs no mana{$?s321758=false}[ and Arcane Missiles fires an additional missile][].
  • description:{$@spelldesc79684=For each ${$c*100/{$s1=200}} mana you spend, you have a 1% chance to gain Clearcasting, making your next Arcane Missiles or Arcane Explosion free and channel {$277726s1=20}% faster.$?a321758[ Arcane Missiles fires {$321758s2=1} additional missile.][]}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Crimson Chorus 5.5 0.0 60.6sec 60.6sec 28.6sec 52.04% 0.00% 0.0 (0.0) 4.9

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_crimson_chorus
  • max_stacks:3
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:60.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:10.00
  • associated item:Cabalist's Hymnal

Stat Details

  • stat:crit_rating
  • amount:95.00

Trigger Details

  • interval_min/max:60.0s / 66.1s
  • trigger_min/max:60.0s / 66.1s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 30.0s

Stack Uptimes

  • crimson_chorus_1:17.94%
  • crimson_chorus_2:17.34%
  • crimson_chorus_3:16.76%

Spelldata

  • id:344803
  • name:Crimson Chorus
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc344806=Join the Crimson Chorus. Every minute, your Critical Strike swells by ${{$s1=44}*3} over ${{$344803d=10 seconds}*3} sec. before returning to normal. This effect is increased by {$s2=5}% for each member of the Crimson Chorus in your party.}
  • max_stacks:3
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Euphoria 3.4 0.0 78.0sec 78.0sec 9.8sec 11.16% 0.00% 0.0 (0.0) 3.3

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_euphoria
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:78.0s / 78.0s
  • trigger_min/max:78.0s / 78.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • euphoria_1:11.16%

Spelldata

  • id:331937
  • name:Euphoria
  • tooltip:Filled with the thrill of battle, increasing Haste by $w1%.
  • description:{$@spelldesc331586=While in combat, you gain a stack of Thrill Seeker every $t1 sec, or {$s1=4} stacks on killing an enemy. At {$331939u=40} stacks Thrill Seeker is consumed to grant you Euphoria, increasing your Haste by {$331937s1=20}% for {$331937d=10 seconds}. Thrill Seeker decays rapidly while you are not in combat.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Evocation 1.1 0.0 223.5sec 223.5sec 4.0sec 1.52% 0.00% 4.5 (4.5) 0.0

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_evocation
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:7.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:1.00

Trigger Details

  • interval_min/max:90.4s / 289.1s
  • trigger_min/max:90.4s / 289.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 4.3s

Stack Uptimes

  • evocation_1:1.52%

Spelldata

  • id:12051
  • name:Evocation
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Gladiator's Badge 2.9 0.0 125.8sec 125.8sec 14.7sec 14.18% 0.00% 0.0 (0.0) 2.8

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_gladiators_badge
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Sinful Aspirant's Badge of Ferocity

Stat Details

  • stat:intellect
  • amount:342.00

Trigger Details

  • interval_min/max:121.1s / 130.8s
  • trigger_min/max:121.1s / 130.8s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 15.0s

Stack Uptimes

  • gladiators_badge_1:14.18%

Spelldata

  • id:345228
  • name:Gladiator's Badge
  • tooltip:Primary stat increased by $w1.
  • description:Increases primary stat by {$s1=252} for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:0.00%
Potion of Deathly Fixation 1.0 0.0 0.0sec 0.0sec 25.0sec 8.45% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_potion_of_deathly_fixation
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:25.0s / 25.0s

Stack Uptimes

  • potion_of_deathly_fixation_1:8.45%

Spelldata

  • id:307497
  • name:Potion of Deathly Fixation
  • tooltip:Chance to apply Deathly Fixation to your target.
  • description:Your damaging spells and abilities have a chance to apply Deathly Fixation to your target, dealing {$322253s1=43} Shadow damage over {$322253d=8 seconds} and stacking up to 5 times. Upon reaching 5 stacks, Deathly Fixation explodes, dealing {$322256s1=985} Shadow damage to the target. If you consume this potion while your weapon is augmented with Shadowcore Oil, the explosion damage is increased by {$s2=10}%. Lasts {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Rune of Power 9.0 0.0 34.4sec 34.4sec 11.8sec 35.43% 0.00% 0.0 (0.0) 8.7

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.0s / 54.1s
  • trigger_min/max:13.0s / 54.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • rune_of_power_1:35.43%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Temporal Warp 1.5 0.0 300.7sec 300.7sec 35.2sec 17.20% 0.00% 0.0 (0.0) 1.1

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_temporal_warp
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:300.0s / 303.6s
  • trigger_min/max:300.0s / 303.6s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 40.0s

Stack Uptimes

  • temporal_warp_1:17.20%

Spelldata

  • id:327355
  • name:Temporal Warp
  • tooltip:Haste increased by $w1%.
  • description:{$@spelldesc327351=While you have Temporal Displacement or other similar effects, you may use Time Warp to grant yourself {$327355s1=30}% Haste for {$327355d=40 seconds}.}
  • max_stacks:0
  • duration:40.00
  • cooldown:0.00
  • default_chance:0.00%
Thrill Seeker 4.4 145.1 78.0sec 2.0sec 66.5sec 97.06% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_thrill_seeker
  • max_stacks:40
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:2.00

Trigger Details

  • interval_min/max:78.0s / 78.0s
  • trigger_min/max:2.0s / 2.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 76.0s

Stack Uptimes

  • thrill_seeker_1:2.93%
  • thrill_seeker_3:2.91%
  • thrill_seeker_4:2.90%
  • thrill_seeker_5:2.87%
  • thrill_seeker_6:2.85%
  • thrill_seeker_7:2.82%
  • thrill_seeker_8:2.79%
  • thrill_seeker_9:2.77%
  • thrill_seeker_10:2.75%
  • thrill_seeker_11:2.72%
  • thrill_seeker_12:2.70%
  • thrill_seeker_13:2.68%
  • thrill_seeker_14:2.67%
  • thrill_seeker_15:2.64%
  • thrill_seeker_16:2.62%
  • thrill_seeker_17:2.60%
  • thrill_seeker_18:2.58%
  • thrill_seeker_19:2.56%
  • thrill_seeker_20:2.53%
  • thrill_seeker_21:2.51%
  • thrill_seeker_22:2.48%
  • thrill_seeker_23:2.47%
  • thrill_seeker_24:2.45%
  • thrill_seeker_25:2.43%
  • thrill_seeker_26:2.42%
  • thrill_seeker_27:2.41%
  • thrill_seeker_28:2.40%
  • thrill_seeker_29:2.38%
  • thrill_seeker_30:2.38%
  • thrill_seeker_31:2.36%
  • thrill_seeker_32:2.35%
  • thrill_seeker_33:2.34%
  • thrill_seeker_34:2.33%
  • thrill_seeker_35:2.32%
  • thrill_seeker_36:2.30%
  • thrill_seeker_37:2.29%
  • thrill_seeker_38:2.28%
  • thrill_seeker_39:2.27%

Spelldata

  • id:331939
  • name:Thrill Seeker
  • tooltip:At {$u=40} stacks, you will gain Euphoria.
  • description:{$@spelldesc331586=While in combat, you gain a stack of Thrill Seeker every $t1 sec, or {$s1=4} stacks on killing an enemy. At {$331939u=40} stacks Thrill Seeker is consumed to grant you Euphoria, increasing your Haste by {$331937s1=20}% for {$331937d=10 seconds}. Thrill Seeker decays rapidly while you are not in combat.}
  • max_stacks:40
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism)

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Benefit Avg % Min Max
Arcane Barrage Arcane Charge 4 100.00% 100.00% 100.00%
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 1.85% 0.43% 5.86% 0.7s 0.0s 4.7s
Conserve Phase 100.00% 100.00% 100.00% 299.9s 240.2s 360.0s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.0000.0000.000179.943120.203239.964
Evocation117.6270.441349.355214.757138.272349.355
Rune of Power5.6510.05119.86235.54420.74149.175
Touch of the Magi4.3950.00023.38828.92719.42748.175
Arcane Power4.5071.09010.79813.1376.33222.142
Arcane Barrage2.6310.0008.476160.980126.968195.473
Arcane Orb3.0060.00010.32140.48329.74353.774
Mirrors of Torment36.5160.00071.927105.43965.142141.827
Time Warp1.0900.0003.5811.6241.2964.881

Burn Phases

Burn phase duration tracks the amount of time spent in each burn phase. This is defined as the time between a start_burn_phase and stop_burn_phase action being executed. Note that "execute" burn phases, i.e., the final burn of a fight, is also included.

Burn Phase Duration
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Mana at burn start is the mana level recorded (in percentage of total mana) when a start_burn_phase command is executed.

Mana at Burn Start
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Venthyr_Nadjia
mana_regen Mana 509.66 393895.69 61.04% 772.85 9578.56 2.37%
Evocation Mana 51.08 58320.60 9.04% 1141.83 0.00 0.00%
Mana Gem Mana 2.77 18640.37 2.89% 6736.57 0.00 0.00%
Arcane Barrage Mana 60.80 156975.07 24.33% 2581.92 6852.29 4.18%
Mirrors of Torment Mana 7.07 17488.37 2.71% 2473.98 1559.73 8.19%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 66365.7 2151.79 2261.16 17954.8 34559.7 127.9 67365.7
Usage Type Count Total Avg RPE APR
Venthyr_Nadjia
arcane_explosion Mana 168.8 647696.6 3836.8 3836.4 1.8
arcane_orb Mana 13.4 5999.1 447.6 447.6 33.1
mirrors_of_torment Mana 2.4 4841.9 2000.0 1998.3 5.3
time_warp Mana 1.5 2970.8 2000.0 1992.1 0.0
touch_of_the_magi Mana 6.2 15612.4 2500.0 2498.8 12.3

Statistics & Data Analysis

Fight Length
Venthyr_Nadjia Fight Length
Count 1319
Mean 299.94
Minimum 240.20
Maximum 359.96
Spread ( max - min ) 119.76
Range [ ( max - min ) / 2 * 100% ] 19.96%
DPS
Venthyr_Nadjia Damage Per Second
Count 1319
Mean 8680.95
Minimum 8021.35
Maximum 9475.61
Spread ( max - min ) 1454.26
Range [ ( max - min ) / 2 * 100% ] 8.38%
Standard Deviation 223.4368
5th Percentile 8337.48
95th Percentile 9072.50
( 95th Percentile - 5th Percentile ) 735.01
Mean Distribution
Standard Deviation 6.1522
95.00% Confidence Interval ( 8668.89 - 8693.00 )
Normalized 95.00% Confidence Interval ( 99.86% - 100.14% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 26
0.1% Error 2545
0.1 Scale Factor Error with Delta=300 427
0.05 Scale Factor Error with Delta=300 1705
0.01 Scale Factor Error with Delta=300 42619
Priority Target DPS
Venthyr_Nadjia Priority Target Damage Per Second
Count 1319
Mean 3724.91
Minimum 3312.56
Maximum 4211.50
Spread ( max - min ) 898.95
Range [ ( max - min ) / 2 * 100% ] 12.07%
Standard Deviation 133.6530
5th Percentile 3517.97
95th Percentile 3961.42
( 95th Percentile - 5th Percentile ) 443.45
Mean Distribution
Standard Deviation 3.6801
95.00% Confidence Interval ( 3717.70 - 3732.13 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 50
0.1% Error 4946
0.1 Scale Factor Error with Delta=300 153
0.05 Scale Factor Error with Delta=300 610
0.01 Scale Factor Error with Delta=300 15249
DPS(e)
Venthyr_Nadjia Damage Per Second (Effective)
Count 1319
Mean 8680.95
Minimum 8021.35
Maximum 9475.61
Spread ( max - min ) 1454.26
Range [ ( max - min ) / 2 * 100% ] 8.38%
Damage
Venthyr_Nadjia Damage
Count 1319
Mean 2596115.82
Minimum 2000289.63
Maximum 3163312.73
Spread ( max - min ) 1163023.10
Range [ ( max - min ) / 2 * 100% ] 22.40%
DTPS
Venthyr_Nadjia Damage Taken Per Second
Count 1319
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Venthyr_Nadjia Healing Per Second
Count 1319
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Venthyr_Nadjia Healing Per Second (Effective)
Count 1319
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Venthyr_Nadjia Heal
Count 1319
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Venthyr_Nadjia Healing Taken Per Second
Count 1319
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Venthyr_Nadjia Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Venthyr_NadjiaTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Venthyr_Nadjia Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 variable,name=prepull_evo,op=reset,default=0
1 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
2 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
3 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
4 0.00 variable,name=have_opened,op=reset,default=0
5 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
6 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
7 0.00 variable,name=final_burn,op=set,value=0
8 0.00 variable,name=rs_max_delay,op=reset,default=5
9 0.00 variable,name=ap_max_delay,op=reset,default=10
A 0.00 variable,name=rop_max_delay,op=reset,default=20
B 0.00 variable,name=totm_max_delay,op=reset,default=5
C 0.00 variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
D 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
E 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
F 0.00 variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
G 0.00 variable,name=barrage_mana_pct,op=reset,default=70
H 0.00 variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
I 0.00 variable,name=ap_minimum_mana_pct,op=reset,default=30
J 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
K 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
L 0.00 variable,name=totm_max_charges,op=reset,default=2
M 0.00 variable,name=aoe_totm_max_charges,op=reset,default=2
N 0.00 variable,name=am_spam,op=reset,default=0
O 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
P 0.00 variable,name=am_spam_evo_pct,op=reset,default=15
Q 0.00 flask
R 0.00 food
S 0.00 augmentation
T 0.00 arcane_familiar
U 0.00 arcane_intellect
V 0.00 conjure_mana_gem
W 0.00 snapshot_stats
X 0.00 mirror_image
Y 0.00 frostbolt,if=variable.prepull_evo<=0
Z 0.00 evocation,if=variable.prepull_evo>0
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
a 0.00 call_action_list,name=shared_cds
b 0.00 call_action_list,name=essences
c 0.00 call_action_list,name=aoe,if=active_enemies>2
d 0.00 call_action_list,name=opener,if=variable.have_opened<=0
e 0.00 call_action_list,name=am_spam,if=variable.am_spam=1
f 0.00 call_action_list,name=cooldowns
g 0.00 call_action_list,name=rotation,if=variable.final_burn=0
h 0.00 call_action_list,name=final_burn,if=variable.final_burn=1
i 0.00 call_action_list,name=movement
actions.aoe
# count action,conditions
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
0.00 arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
j 2.43 mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
k 6.27 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
l 2.89 arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
m 6.13 rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
0.00 presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
0.00 arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
0.00 supernova
n 13.40 arcane_orb,if=buff.arcane_charge.stack=0
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
o 168.81 arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
0.00 arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
p 60.80 arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
q 1.14 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.shared_cds
# count action,conditions
r 2.77 use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
s 2.89 use_items,if=buff.arcane_power.up
t 1.00 potion,if=buff.arcane_power.up
u 1.49 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
0.00 lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
v 1.89 berserking,if=buff.arcane_power.up
0.00 blood_fury,if=buff.arcane_power.up
0.00 fireblood,if=buff.arcane_power.up
0.00 ancestral_call,if=buff.arcane_power.up

Sample Sequence

045789ABGILMNPQRVXYjuklstvpnpoooopoooopoooompoooorpoooopnpoooopoooopoooopoooopoooopnpoooopoooopkmpoooqopnpoooopoooopoooopnpoooopookmpoooopnpoooolspoooopoooropnpoooopoooopjkmpoooopnpoooopoooopoooopnpoooopoooopkmpoooopnpoooopoooopoooopnpoooopoooopklsvpooooprnpoooompoooopoooopnpoooopoooopooouopnpoooopoojkmpoooopoooopnpoooopoooqopoooopnpoo

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 prepull_evo Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat 4 have_opened Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat 5 have_opened Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat 7 final_burn Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat 8 rs_max_delay Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat 9 ap_max_delay Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat A rop_max_delay Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat B totm_max_delay Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat G barrage_mana_pct Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat I ap_minimum_mana_pct Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat L totm_max_charges Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat M aoe_totm_max_charges Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat N am_spam Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat P am_spam_evo_pct Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat Q flask Venthyr_Nadjia 67365.7/67366: 100% mana
Pre precombat R food Venthyr_Nadjia 67365.7/67366: 100% mana
Pre precombat V conjure_mana_gem Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat X mirror_image Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat Y frostbolt Fluffy_Pillow 67365.7/67366: 100% mana
0:00.000 aoe j mirrors_of_torment Fluffy_Pillow 66365.7/67366: 99% mana
0:01.300 shared_cds u time_warp Fluffy_Pillow 65372.5/67366: 97% mana bloodlust, crimson_chorus
0:01.300 aoe k touch_of_the_magi Fluffy_Pillow 63372.5/67366: 94% mana bloodlust, temporal_warp, crimson_chorus
0:02.072 aoe l arcane_power Fluffy_Pillow 61912.6/67366: 92% mana bloodlust, arcane_charge(4), temporal_warp, crimson_chorus, thrill_seeker
0:02.072 shared_cds s use_items Fluffy_Pillow 61912.6/67366: 92% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, crimson_chorus, thrill_seeker
0:02.072 shared_cds t potion Fluffy_Pillow 61912.6/67366: 92% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, crimson_chorus, thrill_seeker, gladiators_badge
0:02.072 shared_cds v berserking Fluffy_Pillow 61912.6/67366: 92% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, crimson_chorus, thrill_seeker, potion_of_deathly_fixation, gladiators_badge
0:02.072 aoe p arcane_barrage Fluffy_Pillow 61912.6/67366: 92% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, crimson_chorus, thrill_seeker, potion_of_deathly_fixation, gladiators_badge
0:02.825 aoe n arcane_orb Fluffy_Pillow 67365.7/67366: 100% mana bloodlust, berserking, arcane_power, rune_of_power, temporal_warp, crimson_chorus, thrill_seeker, potion_of_deathly_fixation, gladiators_badge
0:03.579 aoe p arcane_barrage Fluffy_Pillow 67365.7/67366: 100% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, crimson_chorus, thrill_seeker, potion_of_deathly_fixation, gladiators_badge
0:04.334 aoe o arcane_explosion Fluffy_Pillow 67365.7/67366: 100% mana bloodlust, berserking, arcane_power, rune_of_power, temporal_warp, crimson_chorus, thrill_seeker(3), potion_of_deathly_fixation, gladiators_badge
0:05.089 aoe o arcane_explosion Fluffy_Pillow 65882.9/67366: 98% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, temporal_warp, crimson_chorus, thrill_seeker(3), potion_of_deathly_fixation, gladiators_badge
0:05.842 aoe o arcane_explosion Fluffy_Pillow 64397.5/67366: 96% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, temporal_warp, crimson_chorus, thrill_seeker(3), potion_of_deathly_fixation, gladiators_badge
0:06.598 aoe o arcane_explosion Fluffy_Pillow 62916.0/67366: 93% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, temporal_warp, crimson_chorus, thrill_seeker(4), potion_of_deathly_fixation, gladiators_badge
0:07.353 aoe p arcane_barrage Fluffy_Pillow 61433.3/67366: 91% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, crimson_chorus, thrill_seeker(4), potion_of_deathly_fixation, gladiators_badge
0:08.108 aoe o arcane_explosion Fluffy_Pillow 65145.1/67366: 97% mana bloodlust, berserking, arcane_power, rune_of_power, temporal_warp, crimson_chorus, thrill_seeker(5), potion_of_deathly_fixation, gladiators_badge
0:08.864 aoe o arcane_explosion Fluffy_Pillow 66358.3/67366: 99% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, temporal_warp, crimson_chorus, thrill_seeker(5), potion_of_deathly_fixation, gladiators_badge
0:09.621 aoe o arcane_explosion Fluffy_Pillow 64878.2/67366: 96% mana bloodlust, berserking, arcane_charge(2), arcane_power, clearcasting, rune_of_power, temporal_warp, crimson_chorus, thrill_seeker(5), potion_of_deathly_fixation, gladiators_badge
0:10.376 aoe o arcane_explosion Fluffy_Pillow 65895.4/67366: 98% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, temporal_warp, crimson_chorus(2), thrill_seeker(6), potion_of_deathly_fixation, gladiators_badge
0:11.131 aoe p arcane_barrage Fluffy_Pillow 64412.7/67366: 96% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, crimson_chorus(2), thrill_seeker(6), potion_of_deathly_fixation, gladiators_badge
0:11.886 aoe o arcane_explosion Fluffy_Pillow 67365.7/67366: 100% mana bloodlust, berserking, arcane_power, rune_of_power, temporal_warp, crimson_chorus(2), thrill_seeker(6), potion_of_deathly_fixation, gladiators_badge
0:12.642 aoe o arcane_explosion Fluffy_Pillow 65884.3/67366: 98% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, temporal_warp, crimson_chorus(2), thrill_seeker(7), potion_of_deathly_fixation, gladiators_badge
0:13.396 aoe o arcane_explosion Fluffy_Pillow 64400.2/67366: 96% mana bloodlust, berserking, arcane_charge(2), arcane_power, clearcasting, rune_of_power, temporal_warp, crimson_chorus(2), thrill_seeker(7), potion_of_deathly_fixation, gladiators_badge
0:14.151 aoe o arcane_explosion Fluffy_Pillow 65417.4/67366: 97% mana bloodlust, arcane_charge(3), arcane_power, temporal_warp, crimson_chorus(2), thrill_seeker(8), potion_of_deathly_fixation, gladiators_badge
0:14.921 aoe m rune_of_power Fluffy_Pillow 66649.4/67366: 99% mana bloodlust, arcane_charge(4), arcane_power, temporal_warp, crimson_chorus(2), thrill_seeker(8), potion_of_deathly_fixation, gladiators_badge
0:15.692 aoe p arcane_barrage Fluffy_Pillow 67365.7/67366: 100% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, crimson_chorus(2), thrill_seeker(8), potion_of_deathly_fixation, gladiators_badge
0:16.463 aoe o arcane_explosion Fluffy_Pillow 67365.7/67366: 100% mana bloodlust, arcane_power, rune_of_power, temporal_warp, crimson_chorus(2), thrill_seeker(9), potion_of_deathly_fixation, gladiators_badge
0:17.233 aoe o arcane_explosion Fluffy_Pillow 65903.1/67366: 98% mana bloodlust, arcane_charge, rune_of_power, temporal_warp, crimson_chorus(2), thrill_seeker(9), potion_of_deathly_fixation
0:18.003 aoe o arcane_explosion Fluffy_Pillow 61940.6/67366: 92% mana bloodlust, arcane_charge(2), rune_of_power, temporal_warp, crimson_chorus(2), thrill_seeker(10), potion_of_deathly_fixation
0:18.773 aoe o arcane_explosion Fluffy_Pillow 57978.0/67366: 86% mana bloodlust, arcane_charge(3), rune_of_power, temporal_warp, crimson_chorus(2), thrill_seeker(10), potion_of_deathly_fixation
0:19.544 shared_cds r use_mana_gem Venthyr_Nadjia 54016.8/67366: 80% mana bloodlust, arcane_charge(4), rune_of_power, temporal_warp, crimson_chorus(2), thrill_seeker(10), potion_of_deathly_fixation
0:19.544 aoe p arcane_barrage Fluffy_Pillow 60753.4/67366: 90% mana bloodlust, arcane_charge(4), rune_of_power, temporal_warp, crimson_chorus(2), thrill_seeker(10), potion_of_deathly_fixation
0:20.315 aoe o arcane_explosion Fluffy_Pillow 64486.8/67366: 96% mana bloodlust, rune_of_power, temporal_warp, crimson_chorus(3), thrill_seeker(11), potion_of_deathly_fixation
0:21.086 aoe o arcane_explosion Fluffy_Pillow 60525.5/67366: 90% mana bloodlust, arcane_charge, rune_of_power, temporal_warp, crimson_chorus(3), thrill_seeker(11), potion_of_deathly_fixation
0:21.857 aoe o arcane_explosion Fluffy_Pillow 56564.3/67366: 84% mana bloodlust, arcane_charge(2), rune_of_power, temporal_warp, crimson_chorus(3), thrill_seeker(11), potion_of_deathly_fixation
0:22.628 aoe o arcane_explosion Fluffy_Pillow 52603.1/67366: 78% mana bloodlust, arcane_charge(3), rune_of_power, temporal_warp, crimson_chorus(3), thrill_seeker(12), potion_of_deathly_fixation
0:23.398 aoe p arcane_barrage Fluffy_Pillow 48640.5/67366: 72% mana bloodlust, arcane_charge(4), rune_of_power, temporal_warp, crimson_chorus(3), thrill_seeker(12), potion_of_deathly_fixation
0:24.169 aoe n arcane_orb Fluffy_Pillow 52373.9/67366: 78% mana bloodlust, rune_of_power, temporal_warp, crimson_chorus(3), thrill_seeker(13), potion_of_deathly_fixation
0:24.939 aoe p arcane_barrage Fluffy_Pillow 52911.4/67366: 79% mana bloodlust, arcane_charge(4), rune_of_power, temporal_warp, crimson_chorus(3), thrill_seeker(13), potion_of_deathly_fixation
0:25.710 aoe o arcane_explosion Fluffy_Pillow 56644.8/67366: 84% mana bloodlust, rune_of_power, temporal_warp, crimson_chorus(3), thrill_seeker(13), potion_of_deathly_fixation
0:26.481 aoe o arcane_explosion Fluffy_Pillow 52683.6/67366: 78% mana bloodlust, arcane_charge, rune_of_power, temporal_warp, crimson_chorus(3), thrill_seeker(14), potion_of_deathly_fixation
0:27.251 aoe o arcane_explosion Fluffy_Pillow 48721.0/67366: 72% mana bloodlust, arcane_charge(2), rune_of_power, temporal_warp, crimson_chorus(3), thrill_seeker(14)
0:28.022 aoe o arcane_explosion Fluffy_Pillow 44759.8/67366: 66% mana bloodlust, arcane_charge(3), temporal_warp, crimson_chorus(3), thrill_seeker(15)
0:28.792 aoe p arcane_barrage Fluffy_Pillow 40797.2/67366: 61% mana bloodlust, arcane_charge(4), clearcasting, temporal_warp, crimson_chorus(3), thrill_seeker(15)
0:29.562 aoe o arcane_explosion Fluffy_Pillow 44529.3/67366: 66% mana bloodlust, clearcasting, temporal_warp, crimson_chorus(3), thrill_seeker(15)
0:30.335 aoe o arcane_explosion Fluffy_Pillow 45570.7/67366: 68% mana bloodlust, arcane_charge, temporal_warp, thrill_seeker(16)
0:31.106 aoe o arcane_explosion Fluffy_Pillow 41609.5/67366: 62% mana bloodlust, arcane_charge(2), temporal_warp, thrill_seeker(16)
0:31.875 aoe o arcane_explosion Fluffy_Pillow 37645.6/67366: 56% mana bloodlust, arcane_charge(3), temporal_warp, thrill_seeker(16)
0:32.646 aoe p arcane_barrage Fluffy_Pillow 33684.4/67366: 50% mana bloodlust, arcane_charge(4), temporal_warp, thrill_seeker(17)
0:33.416 aoe o arcane_explosion Fluffy_Pillow 37416.4/67366: 56% mana bloodlust, temporal_warp, thrill_seeker(17)
0:34.186 aoe o arcane_explosion Fluffy_Pillow 33453.9/67366: 50% mana bloodlust, arcane_charge, temporal_warp, thrill_seeker(18)
0:34.958 aoe o arcane_explosion Fluffy_Pillow 29494.0/67366: 44% mana bloodlust, arcane_charge(2), temporal_warp, thrill_seeker(18)
0:35.727 aoe o arcane_explosion Fluffy_Pillow 25530.1/67366: 38% mana bloodlust, arcane_charge(3), temporal_warp, thrill_seeker(18)
0:36.499 aoe p arcane_barrage Fluffy_Pillow 21570.2/67366: 32% mana bloodlust, arcane_charge(4), temporal_warp, thrill_seeker(19)
0:37.269 aoe o arcane_explosion Fluffy_Pillow 25302.3/67366: 38% mana bloodlust, temporal_warp, thrill_seeker(19)
0:38.040 aoe o arcane_explosion Fluffy_Pillow 21341.1/67366: 32% mana bloodlust, arcane_charge, clearcasting, temporal_warp, thrill_seeker(20)
0:38.810 aoe o arcane_explosion Fluffy_Pillow 22378.5/67366: 33% mana bloodlust, arcane_charge(2), temporal_warp, thrill_seeker(20)
0:39.581 aoe o arcane_explosion Fluffy_Pillow 18417.3/67366: 27% mana bloodlust, arcane_charge(3), temporal_warp, thrill_seeker(20)
0:40.351 aoe p arcane_barrage Fluffy_Pillow 14454.7/67366: 21% mana bloodlust, arcane_charge(4), temporal_warp, thrill_seeker(21)
0:41.122 aoe o arcane_explosion Fluffy_Pillow 18188.1/67366: 27% mana temporal_warp, thrill_seeker(21)
0:42.122 aoe o arcane_explosion Fluffy_Pillow 14535.4/67366: 22% mana arcane_charge, thrill_seeker(22)
0:43.421 aoe o arcane_explosion Fluffy_Pillow 11285.6/67366: 17% mana arcane_charge(2), clearcasting, thrill_seeker(22)
0:44.720 aoe o arcane_explosion Fluffy_Pillow 13035.7/67366: 19% mana arcane_charge(3), thrill_seeker(23)
0:46.020 aoe p arcane_barrage Fluffy_Pillow 9787.3/67366: 15% mana arcane_charge(4), thrill_seeker(24)
0:47.321 aoe n arcane_orb Fluffy_Pillow 14234.7/67366: 21% mana thrill_seeker(24)
0:48.621 aoe p arcane_barrage Fluffy_Pillow 15486.2/67366: 23% mana arcane_charge(4), thrill_seeker(25)
0:49.922 aoe o arcane_explosion Fluffy_Pillow 19933.7/67366: 30% mana thrill_seeker(25)
0:51.223 aoe o arcane_explosion Fluffy_Pillow 16686.6/67366: 25% mana arcane_charge, thrill_seeker(26)
0:52.522 aoe o arcane_explosion Fluffy_Pillow 13436.7/67366: 20% mana arcane_charge(2), clearcasting, thrill_seeker(27)
0:53.819 aoe o arcane_explosion Fluffy_Pillow 15184.2/67366: 23% mana arcane_charge(3), thrill_seeker(27)
0:55.120 aoe p arcane_barrage Fluffy_Pillow 11937.1/67366: 18% mana arcane_charge(4), thrill_seeker(28)
0:56.419 aoe o arcane_explosion Fluffy_Pillow 16381.9/67366: 24% mana thrill_seeker(29)
0:57.720 aoe o arcane_explosion Fluffy_Pillow 13134.7/67366: 19% mana arcane_charge, thrill_seeker(29)
0:59.019 aoe o arcane_explosion Fluffy_Pillow 9884.9/67366: 15% mana arcane_charge(2), thrill_seeker(30)
1:00.319 aoe o arcane_explosion Fluffy_Pillow 6636.4/67366: 10% mana arcane_charge(3), thrill_seeker(31)
1:01.619 aoe p arcane_barrage Fluffy_Pillow 3387.9/67366: 5% mana arcane_charge(4), crimson_chorus, thrill_seeker(31)
1:02.919 aoe k touch_of_the_magi Fluffy_Pillow 7834.0/67366: 12% mana crimson_chorus, thrill_seeker(32)
1:04.218 aoe m rune_of_power Fluffy_Pillow 7084.2/67366: 11% mana arcane_charge(4), crimson_chorus, thrill_seeker(33)
1:05.517 aoe p arcane_barrage Fluffy_Pillow 8834.4/67366: 13% mana arcane_charge(4), rune_of_power, crimson_chorus, thrill_seeker(33)
1:06.816 aoe o arcane_explosion Fluffy_Pillow 13279.1/67366: 20% mana rune_of_power, crimson_chorus, thrill_seeker(34)
1:08.115 aoe o arcane_explosion Fluffy_Pillow 10029.3/67366: 15% mana arcane_charge, rune_of_power, crimson_chorus, thrill_seeker(35)
1:09.415 aoe o arcane_explosion Fluffy_Pillow 6780.8/67366: 10% mana arcane_charge(2), rune_of_power, crimson_chorus, thrill_seeker(35)
1:10.714 aoe q evocation Venthyr_Nadjia 3531.0/67366: 5% mana arcane_charge(3), rune_of_power, crimson_chorus(2), thrill_seeker(36)
1:15.035 aoe o arcane_explosion Fluffy_Pillow 60742.0/67366: 90% mana arcane_charge(3), rune_of_power, crimson_chorus(2), thrill_seeker(38)
1:16.334 aoe p arcane_barrage Fluffy_Pillow 57492.1/67366: 85% mana arcane_charge(4), rune_of_power, crimson_chorus(2), thrill_seeker(39)
1:17.632 aoe n arcane_orb Fluffy_Pillow 61935.6/67366: 92% mana crimson_chorus(2), thrill_seeker(39)
1:18.932 aoe p arcane_barrage Fluffy_Pillow 63187.1/67366: 94% mana arcane_charge(4), crimson_chorus(2), euphoria
1:20.015 aoe o arcane_explosion Fluffy_Pillow 67340.8/67366: 100% mana crimson_chorus(2), thrill_seeker, euphoria
1:21.098 aoe o arcane_explosion Fluffy_Pillow 63800.0/67366: 95% mana arcane_charge, crimson_chorus(3), thrill_seeker, euphoria
1:22.180 aoe o arcane_explosion Fluffy_Pillow 60257.8/67366: 89% mana arcane_charge(2), crimson_chorus(3), thrill_seeker(3), euphoria
1:23.263 aoe o arcane_explosion Fluffy_Pillow 56716.9/67366: 84% mana arcane_charge(3), crimson_chorus(3), thrill_seeker(3), euphoria
1:24.346 aoe p arcane_barrage Fluffy_Pillow 53176.1/67366: 79% mana arcane_charge(4), crimson_chorus(3), thrill_seeker(4), euphoria
1:25.430 aoe o arcane_explosion Fluffy_Pillow 57331.2/67366: 85% mana crimson_chorus(3), thrill_seeker(4), euphoria
1:26.514 aoe o arcane_explosion Fluffy_Pillow 53791.7/67366: 80% mana arcane_charge, crimson_chorus(3), thrill_seeker(5), euphoria
1:27.597 aoe o arcane_explosion Fluffy_Pillow 50250.8/67366: 75% mana arcane_charge(2), crimson_chorus(3), thrill_seeker(5), euphoria
1:28.681 aoe o arcane_explosion Fluffy_Pillow 46711.3/67366: 69% mana arcane_charge(3), crimson_chorus(3), thrill_seeker(6)
1:29.981 aoe p arcane_barrage Fluffy_Pillow 43462.8/67366: 65% mana arcane_charge(4), crimson_chorus(3), thrill_seeker(6)
1:31.280 aoe o arcane_explosion Fluffy_Pillow 47907.6/67366: 71% mana thrill_seeker(7)
1:32.581 aoe o arcane_explosion Fluffy_Pillow 44660.5/67366: 66% mana arcane_charge, clearcasting, thrill_seeker(8)
1:33.881 aoe o arcane_explosion Fluffy_Pillow 46412.0/67366: 69% mana arcane_charge(2), thrill_seeker(8)
1:35.180 aoe o arcane_explosion Fluffy_Pillow 43162.1/67366: 64% mana arcane_charge(3), clearcasting, thrill_seeker(9)
1:36.479 aoe p arcane_barrage Fluffy_Pillow 44912.3/67366: 67% mana arcane_charge(4), thrill_seeker(10)
1:37.778 aoe n arcane_orb Fluffy_Pillow 49357.1/67366: 73% mana thrill_seeker(10)
1:39.078 aoe p arcane_barrage Fluffy_Pillow 50608.6/67366: 75% mana arcane_charge(4), thrill_seeker(11)
1:40.376 aoe o arcane_explosion Fluffy_Pillow 55052.0/67366: 82% mana thrill_seeker(12)
1:41.675 aoe o arcane_explosion Fluffy_Pillow 51802.2/67366: 77% mana arcane_charge, thrill_seeker(12)
1:42.974 aoe o arcane_explosion Fluffy_Pillow 48552.3/67366: 72% mana arcane_charge(2), thrill_seeker(13)
1:44.273 aoe o arcane_explosion Fluffy_Pillow 45302.5/67366: 67% mana arcane_charge(3), thrill_seeker(14)
1:45.574 aoe p arcane_barrage Fluffy_Pillow 42055.4/67366: 62% mana arcane_charge(4), thrill_seeker(14)
1:46.874 aoe o arcane_explosion Fluffy_Pillow 46501.5/67366: 69% mana thrill_seeker(15)
1:48.174 aoe o arcane_explosion Fluffy_Pillow 43253.0/67366: 64% mana arcane_charge, thrill_seeker(16)
1:49.474 aoe k touch_of_the_magi Fluffy_Pillow 40004.5/67366: 59% mana arcane_charge(2), thrill_seeker(16)
1:50.772 aoe m rune_of_power Fluffy_Pillow 39253.3/67366: 58% mana arcane_charge(4), thrill_seeker(17)
1:52.072 aoe p arcane_barrage Fluffy_Pillow 41004.8/67366: 61% mana arcane_charge(4), rune_of_power, thrill_seeker(18)
1:53.372 aoe o arcane_explosion Fluffy_Pillow 45451.0/67366: 67% mana rune_of_power, thrill_seeker(18)
1:54.672 aoe o arcane_explosion Fluffy_Pillow 42202.5/67366: 63% mana arcane_charge, rune_of_power, thrill_seeker(19)
1:55.972 aoe o arcane_explosion Fluffy_Pillow 38954.0/67366: 58% mana arcane_charge(2), rune_of_power, thrill_seeker(19)
1:57.272 aoe o arcane_explosion Fluffy_Pillow 35705.5/67366: 53% mana arcane_charge(3), rune_of_power, thrill_seeker(20)
1:58.572 aoe p arcane_barrage Fluffy_Pillow 32457.0/67366: 48% mana arcane_charge(4), rune_of_power, thrill_seeker(21)
1:59.873 aoe n arcane_orb Fluffy_Pillow 36904.5/67366: 55% mana rune_of_power, thrill_seeker(21)
2:01.172 aoe p arcane_barrage Fluffy_Pillow 38154.7/67366: 57% mana arcane_charge(4), rune_of_power, crimson_chorus, thrill_seeker(22)
2:02.469 aoe o arcane_explosion Fluffy_Pillow 42596.8/67366: 63% mana rune_of_power, crimson_chorus, thrill_seeker(23)
2:03.768 aoe o arcane_explosion Fluffy_Pillow 39346.9/67366: 58% mana arcane_charge, rune_of_power, crimson_chorus, thrill_seeker(23)
2:05.068 aoe o arcane_explosion Fluffy_Pillow 36098.4/67366: 54% mana arcane_charge(2), crimson_chorus, thrill_seeker(24)
2:06.367 aoe o arcane_explosion Fluffy_Pillow 32848.6/67366: 49% mana arcane_charge(3), clearcasting, crimson_chorus, thrill_seeker(25)
2:07.667 aoe l arcane_power Fluffy_Pillow 34600.1/67366: 51% mana arcane_charge(4), crimson_chorus, thrill_seeker(25)
2:07.667 shared_cds s use_items Fluffy_Pillow 34600.1/67366: 51% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus, thrill_seeker(25)
2:07.667 aoe p arcane_barrage Fluffy_Pillow 34600.1/67366: 51% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus, thrill_seeker(25), gladiators_badge
2:08.966 aoe o arcane_explosion Fluffy_Pillow 39044.9/67366: 58% mana arcane_power, rune_of_power, crimson_chorus, thrill_seeker(26), gladiators_badge
2:10.265 aoe o arcane_explosion Fluffy_Pillow 38295.0/67366: 57% mana arcane_charge, arcane_power, rune_of_power, crimson_chorus, thrill_seeker(27), gladiators_badge
2:11.565 aoe o arcane_explosion Fluffy_Pillow 37546.6/67366: 56% mana arcane_charge(2), arcane_power, rune_of_power, crimson_chorus(2), thrill_seeker(27), gladiators_badge
2:12.865 aoe o arcane_explosion Fluffy_Pillow 36798.1/67366: 55% mana arcane_charge(3), arcane_power, rune_of_power, crimson_chorus(2), thrill_seeker(28), gladiators_badge
2:14.164 aoe p arcane_barrage Fluffy_Pillow 36048.2/67366: 54% mana arcane_charge(4), arcane_power, clearcasting, rune_of_power, crimson_chorus(2), thrill_seeker(29), gladiators_badge
2:15.463 aoe o arcane_explosion Fluffy_Pillow 40493.0/67366: 60% mana arcane_power, clearcasting, rune_of_power, crimson_chorus(2), thrill_seeker(29), gladiators_badge
2:16.763 aoe o arcane_explosion Fluffy_Pillow 42244.5/67366: 63% mana arcane_charge, arcane_power, rune_of_power, crimson_chorus(2), thrill_seeker(30), gladiators_badge
2:18.062 aoe o arcane_explosion Fluffy_Pillow 41494.7/67366: 62% mana arcane_charge(2), arcane_power, rune_of_power, crimson_chorus(2), thrill_seeker(31), gladiators_badge
2:19.361 shared_cds r use_mana_gem Venthyr_Nadjia 40744.8/67366: 60% mana arcane_charge(3), arcane_power, rune_of_power, crimson_chorus(2), thrill_seeker(31), gladiators_badge
2:19.544 aoe o arcane_explosion Fluffy_Pillow 47728.0/67366: 71% mana arcane_charge(3), arcane_power, rune_of_power, crimson_chorus(2), thrill_seeker(31), gladiators_badge
2:20.843 aoe p arcane_barrage Fluffy_Pillow 46978.1/67366: 70% mana arcane_charge(4), arcane_power, crimson_chorus(3), thrill_seeker(32), gladiators_badge
2:22.140 aoe n arcane_orb Fluffy_Pillow 51420.2/67366: 76% mana arcane_power, crimson_chorus(3), thrill_seeker(33), gladiators_badge
2:23.440 aoe p arcane_barrage Fluffy_Pillow 52921.7/67366: 79% mana arcane_charge(4), crimson_chorus(3), thrill_seeker(33)
2:24.738 aoe o arcane_explosion Fluffy_Pillow 57365.2/67366: 85% mana crimson_chorus(3), thrill_seeker(34)
2:26.038 aoe o arcane_explosion Fluffy_Pillow 54116.7/67366: 80% mana arcane_charge, clearcasting, crimson_chorus(3), thrill_seeker(35)
2:27.336 aoe o arcane_explosion Fluffy_Pillow 55865.5/67366: 83% mana arcane_charge(2), crimson_chorus(3), thrill_seeker(35)
2:28.636 aoe o arcane_explosion Fluffy_Pillow 52617.0/67366: 78% mana arcane_charge(3), crimson_chorus(3), thrill_seeker(36)
2:29.934 aoe p arcane_barrage Fluffy_Pillow 49365.8/67366: 73% mana arcane_charge(4), crimson_chorus(3), thrill_seeker(36)
2:31.234 aoe o arcane_explosion Fluffy_Pillow 53812.0/67366: 80% mana thrill_seeker(37)
2:32.534 aoe o arcane_explosion Fluffy_Pillow 50563.5/67366: 75% mana arcane_charge, thrill_seeker(38)
2:33.835 aoe o arcane_explosion Fluffy_Pillow 47316.3/67366: 70% mana arcane_charge(2), thrill_seeker(38)
2:35.134 aoe o arcane_explosion Fluffy_Pillow 44066.5/67366: 65% mana arcane_charge(3), thrill_seeker(39)
2:36.435 aoe p arcane_barrage Fluffy_Pillow 40819.3/67366: 61% mana arcane_charge(4), euphoria
2:37.520 aoe j mirrors_of_torment Fluffy_Pillow 44975.8/67366: 67% mana euphoria
2:38.605 aoe k touch_of_the_magi Fluffy_Pillow 44437.6/67366: 66% mana clearcasting, thrill_seeker, euphoria
2:39.689 aoe m rune_of_power Fluffy_Pillow 43398.1/67366: 64% mana arcane_charge(4), clearcasting, thrill_seeker, euphoria
2:40.772 aoe p arcane_barrage Fluffy_Pillow 47551.9/67366: 71% mana arcane_charge(4), clearcasting(2), rune_of_power, thrill_seeker(3), euphoria
2:41.855 aoe o arcane_explosion Fluffy_Pillow 51705.7/67366: 77% mana clearcasting(2), rune_of_power, thrill_seeker(3), euphoria
2:42.938 aoe o arcane_explosion Fluffy_Pillow 53164.8/67366: 79% mana arcane_charge, clearcasting, rune_of_power, thrill_seeker(4), euphoria
2:44.021 aoe o arcane_explosion Fluffy_Pillow 54624.0/67366: 81% mana arcane_charge(2), rune_of_power, thrill_seeker(5), euphoria
2:45.104 aoe o arcane_explosion Fluffy_Pillow 51083.1/67366: 76% mana arcane_charge(3), rune_of_power, thrill_seeker(5), euphoria
2:46.189 aoe p arcane_barrage Fluffy_Pillow 50239.6/67366: 75% mana arcane_charge(4), rune_of_power, thrill_seeker(6)
2:47.488 aoe n arcane_orb Fluffy_Pillow 54684.4/67366: 81% mana rune_of_power, thrill_seeker(6)
2:48.788 aoe p arcane_barrage Fluffy_Pillow 55935.9/67366: 83% mana arcane_charge(4), rune_of_power, thrill_seeker(7)
2:50.088 aoe o arcane_explosion Fluffy_Pillow 60382.0/67366: 90% mana rune_of_power, thrill_seeker(8)
2:51.387 aoe o arcane_explosion Fluffy_Pillow 57132.2/67366: 85% mana arcane_charge, clearcasting, rune_of_power, thrill_seeker(8)
2:52.687 aoe o arcane_explosion Fluffy_Pillow 61578.3/67366: 91% mana arcane_charge(2), rune_of_power, thrill_seeker(9)
2:53.987 aoe o arcane_explosion Fluffy_Pillow 58329.8/67366: 87% mana arcane_charge(3), clearcasting, thrill_seeker(9)
2:55.286 aoe p arcane_barrage Fluffy_Pillow 60080.0/67366: 89% mana arcane_charge(4), thrill_seeker(10)
2:56.587 aoe o arcane_explosion Fluffy_Pillow 64527.5/67366: 96% mana thrill_seeker(11)
2:57.886 aoe o arcane_explosion Fluffy_Pillow 61277.6/67366: 91% mana arcane_charge, thrill_seeker(11)
2:59.186 aoe o arcane_explosion Fluffy_Pillow 58029.1/67366: 86% mana arcane_charge(2), thrill_seeker(12)
3:00.485 aoe o arcane_explosion Fluffy_Pillow 54779.3/67366: 81% mana arcane_charge(3), clearcasting, thrill_seeker(13)
3:01.784 aoe p arcane_barrage Fluffy_Pillow 56529.4/67366: 84% mana arcane_charge(4), crimson_chorus, thrill_seeker(13)
3:03.084 aoe o arcane_explosion Fluffy_Pillow 60975.6/67366: 91% mana crimson_chorus, thrill_seeker(14)
3:04.385 aoe o arcane_explosion Fluffy_Pillow 57728.4/67366: 86% mana arcane_charge, crimson_chorus, thrill_seeker(15)
3:05.685 aoe o arcane_explosion Fluffy_Pillow 54479.9/67366: 81% mana arcane_charge(2), clearcasting, crimson_chorus, thrill_seeker(15)
3:06.985 aoe o arcane_explosion Fluffy_Pillow 56231.5/67366: 83% mana arcane_charge(3), crimson_chorus, thrill_seeker(16)
3:08.284 aoe p arcane_barrage Fluffy_Pillow 52981.6/67366: 79% mana arcane_charge(4), crimson_chorus, thrill_seeker(17)
3:09.583 aoe n arcane_orb Fluffy_Pillow 57426.4/67366: 85% mana crimson_chorus, thrill_seeker(17)
3:10.883 aoe p arcane_barrage Fluffy_Pillow 58677.9/67366: 87% mana arcane_charge(4), crimson_chorus(2), thrill_seeker(18)
3:12.183 aoe o arcane_explosion Fluffy_Pillow 63124.0/67366: 94% mana crimson_chorus(2), thrill_seeker(19)
3:13.481 aoe o arcane_explosion Fluffy_Pillow 59872.9/67366: 89% mana arcane_charge, crimson_chorus(2), thrill_seeker(19)
3:14.782 aoe o arcane_explosion Fluffy_Pillow 56625.7/67366: 84% mana arcane_charge(2), crimson_chorus(2), thrill_seeker(20)
3:16.080 aoe o arcane_explosion Fluffy_Pillow 53374.5/67366: 79% mana arcane_charge(3), crimson_chorus(2), thrill_seeker(21)
3:17.380 aoe p arcane_barrage Fluffy_Pillow 50126.0/67366: 74% mana arcane_charge(4), crimson_chorus(2), thrill_seeker(21)
3:18.679 aoe o arcane_explosion Fluffy_Pillow 54570.8/67366: 81% mana crimson_chorus(2), thrill_seeker(22)
3:19.979 aoe o arcane_explosion Fluffy_Pillow 51322.3/67366: 76% mana arcane_charge, crimson_chorus(2), thrill_seeker(22)
3:21.279 aoe o arcane_explosion Fluffy_Pillow 48073.8/67366: 71% mana arcane_charge(2), crimson_chorus(3), thrill_seeker(23)
3:22.581 aoe o arcane_explosion Fluffy_Pillow 44828.1/67366: 67% mana arcane_charge(3), crimson_chorus(3), thrill_seeker(24)
3:23.882 aoe p arcane_barrage Fluffy_Pillow 41580.9/67366: 62% mana arcane_charge(4), clearcasting, crimson_chorus(3), thrill_seeker(24)
3:25.181 aoe k touch_of_the_magi Fluffy_Pillow 46025.7/67366: 68% mana clearcasting, crimson_chorus(3), thrill_seeker(25)
3:26.480 aoe m rune_of_power Fluffy_Pillow 45275.9/67366: 67% mana arcane_charge(4), clearcasting, crimson_chorus(3), thrill_seeker(26)
3:27.780 aoe p arcane_barrage Fluffy_Pillow 47027.4/67366: 70% mana arcane_charge(4), clearcasting(2), rune_of_power, crimson_chorus(3), thrill_seeker(26)
3:29.082 aoe o arcane_explosion Fluffy_Pillow 51476.2/67366: 76% mana clearcasting(2), rune_of_power, crimson_chorus(3), thrill_seeker(27)
3:30.381 aoe o arcane_explosion Fluffy_Pillow 53226.4/67366: 79% mana arcane_charge, clearcasting, rune_of_power, crimson_chorus(3), thrill_seeker(28)
3:31.681 aoe o arcane_explosion Fluffy_Pillow 54977.9/67366: 82% mana arcane_charge(2), rune_of_power, thrill_seeker(28)
3:32.980 aoe o arcane_explosion Fluffy_Pillow 51728.0/67366: 77% mana arcane_charge(3), clearcasting, rune_of_power, thrill_seeker(29)
3:34.280 aoe p arcane_barrage Fluffy_Pillow 53479.5/67366: 79% mana arcane_charge(4), rune_of_power, thrill_seeker(30)
3:35.579 aoe n arcane_orb Fluffy_Pillow 57924.3/67366: 86% mana rune_of_power, thrill_seeker(30)
3:36.878 aoe p arcane_barrage Fluffy_Pillow 59174.5/67366: 88% mana arcane_charge(4), rune_of_power, thrill_seeker(31)
3:38.177 aoe o arcane_explosion Fluffy_Pillow 63619.3/67366: 94% mana rune_of_power, thrill_seeker(32)
3:39.477 aoe o arcane_explosion Fluffy_Pillow 60370.8/67366: 90% mana arcane_charge, rune_of_power, thrill_seeker(32)
3:40.778 aoe o arcane_explosion Fluffy_Pillow 57123.6/67366: 85% mana arcane_charge(2), clearcasting, thrill_seeker(33)
3:42.076 aoe o arcane_explosion Fluffy_Pillow 58872.5/67366: 87% mana arcane_charge(3), thrill_seeker(34)
3:43.374 aoe p arcane_barrage Fluffy_Pillow 55621.3/67366: 83% mana arcane_charge(4), thrill_seeker(34)
3:44.674 aoe o arcane_explosion Fluffy_Pillow 60067.4/67366: 89% mana thrill_seeker(35)
3:45.974 aoe o arcane_explosion Fluffy_Pillow 56818.9/67366: 84% mana arcane_charge, thrill_seeker(35)
3:47.273 aoe o arcane_explosion Fluffy_Pillow 53569.1/67366: 80% mana arcane_charge(2), thrill_seeker(36)
3:48.573 aoe o arcane_explosion Fluffy_Pillow 50320.6/67366: 75% mana arcane_charge(3), thrill_seeker(37)
3:49.872 aoe p arcane_barrage Fluffy_Pillow 47070.7/67366: 70% mana arcane_charge(4), thrill_seeker(37)
3:51.172 aoe o arcane_explosion Fluffy_Pillow 51516.9/67366: 76% mana thrill_seeker(38)
3:52.470 aoe o arcane_explosion Fluffy_Pillow 48265.7/67366: 72% mana arcane_charge, thrill_seeker(39)
3:53.769 aoe o arcane_explosion Fluffy_Pillow 45015.9/67366: 67% mana arcane_charge(2), thrill_seeker(39)
3:55.068 aoe o arcane_explosion Fluffy_Pillow 41766.0/67366: 62% mana arcane_charge(3), euphoria
3:56.151 aoe p arcane_barrage Fluffy_Pillow 38225.2/67366: 57% mana arcane_charge(4), clearcasting, thrill_seeker, euphoria
3:57.234 aoe n arcane_orb Fluffy_Pillow 42378.9/67366: 63% mana clearcasting, thrill_seeker, euphoria
3:58.316 aoe p arcane_barrage Fluffy_Pillow 43336.7/67366: 64% mana arcane_charge(4), clearcasting, thrill_seeker(3), euphoria
3:59.400 aoe o arcane_explosion Fluffy_Pillow 47491.8/67366: 70% mana clearcasting, thrill_seeker(3), euphoria
4:00.483 aoe o arcane_explosion Fluffy_Pillow 48951.0/67366: 73% mana arcane_charge, thrill_seeker(4), euphoria
4:01.566 aoe o arcane_explosion Fluffy_Pillow 45410.1/67366: 67% mana arcane_charge(2), thrill_seeker(4), euphoria
4:02.650 aoe o arcane_explosion Fluffy_Pillow 41870.6/67366: 62% mana arcane_charge(3), clearcasting, crimson_chorus, thrill_seeker(5), euphoria
4:03.733 aoe p arcane_barrage Fluffy_Pillow 43329.8/67366: 64% mana arcane_charge(4), crimson_chorus, thrill_seeker(5), euphoria
4:04.816 aoe o arcane_explosion Fluffy_Pillow 47483.5/67366: 70% mana crimson_chorus, thrill_seeker(6)
4:06.114 aoe o arcane_explosion Fluffy_Pillow 44232.3/67366: 66% mana arcane_charge, crimson_chorus, thrill_seeker(7)
4:07.413 aoe o arcane_explosion Fluffy_Pillow 40982.5/67366: 61% mana arcane_charge(2), crimson_chorus, thrill_seeker(7)
4:08.712 aoe o arcane_explosion Fluffy_Pillow 37732.7/67366: 56% mana arcane_charge(3), crimson_chorus, thrill_seeker(8)
4:10.013 aoe p arcane_barrage Fluffy_Pillow 34485.5/67366: 51% mana arcane_charge(4), crimson_chorus, thrill_seeker(9)
4:11.313 aoe k touch_of_the_magi Fluffy_Pillow 38931.7/67366: 58% mana crimson_chorus, thrill_seeker(9)
4:12.774 aoe l arcane_power Fluffy_Pillow 38400.1/67366: 57% mana arcane_charge(4), crimson_chorus(2), thrill_seeker(10)
4:12.774 shared_cds s use_items Fluffy_Pillow 38400.1/67366: 57% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), thrill_seeker(10)
4:12.774 shared_cds v berserking Fluffy_Pillow 38400.1/67366: 57% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), thrill_seeker(10), gladiators_badge
4:12.774 aoe p arcane_barrage Fluffy_Pillow 38400.1/67366: 57% mana berserking, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), thrill_seeker(10), gladiators_badge
4:13.956 aoe o arcane_explosion Fluffy_Pillow 42687.2/67366: 63% mana berserking, arcane_power, rune_of_power, crimson_chorus(2), thrill_seeker(10), gladiators_badge
4:15.139 aoe o arcane_explosion Fluffy_Pillow 41781.1/67366: 62% mana berserking, arcane_charge, arcane_power, rune_of_power, crimson_chorus(2), thrill_seeker(11), gladiators_badge
4:16.322 aoe o arcane_explosion Fluffy_Pillow 40875.0/67366: 61% mana berserking, arcane_charge(2), arcane_power, rune_of_power, crimson_chorus(2), thrill_seeker(12), gladiators_badge
4:17.505 aoe o arcane_explosion Fluffy_Pillow 39968.9/67366: 59% mana berserking, arcane_charge(3), arcane_power, rune_of_power, crimson_chorus(2), thrill_seeker(12), gladiators_badge
4:18.687 aoe p arcane_barrage Fluffy_Pillow 39061.4/67366: 58% mana berserking, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), thrill_seeker(13), gladiators_badge
4:19.869 shared_cds r use_mana_gem Venthyr_Nadjia 43348.5/67366: 64% mana berserking, arcane_power, rune_of_power, crimson_chorus(2), thrill_seeker(13), gladiators_badge
4:19.869 aoe n arcane_orb Fluffy_Pillow 50085.1/67366: 74% mana berserking, arcane_power, rune_of_power, crimson_chorus(2), thrill_seeker(13), gladiators_badge
4:21.051 aoe p arcane_barrage Fluffy_Pillow 51427.6/67366: 76% mana berserking, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), thrill_seeker(14), gladiators_badge
4:22.233 aoe o arcane_explosion Fluffy_Pillow 55714.8/67366: 83% mana berserking, arcane_power, rune_of_power, crimson_chorus(3), thrill_seeker(15), gladiators_badge
4:23.416 aoe o arcane_explosion Fluffy_Pillow 54808.7/67366: 81% mana berserking, arcane_charge, arcane_power, rune_of_power, crimson_chorus(3), thrill_seeker(15), gladiators_badge
4:24.597 aoe o arcane_explosion Fluffy_Pillow 53899.8/67366: 80% mana berserking, arcane_charge(2), arcane_power, clearcasting, rune_of_power, crimson_chorus(3), thrill_seeker(16), gladiators_badge
4:25.778 aoe o arcane_explosion Fluffy_Pillow 55491.0/67366: 82% mana arcane_charge(3), arcane_power, crimson_chorus(3), thrill_seeker(16), gladiators_badge
4:27.078 aoe m rune_of_power Fluffy_Pillow 54742.5/67366: 81% mana arcane_charge(4), arcane_power, crimson_chorus(3), thrill_seeker(17), gladiators_badge
4:28.377 aoe p arcane_barrage Fluffy_Pillow 56492.7/67366: 84% mana arcane_charge(4), rune_of_power, crimson_chorus(3), thrill_seeker(18)
4:29.676 aoe o arcane_explosion Fluffy_Pillow 60937.5/67366: 90% mana rune_of_power, crimson_chorus(3), thrill_seeker(18)
4:30.975 aoe o arcane_explosion Fluffy_Pillow 57687.6/67366: 86% mana arcane_charge, rune_of_power, crimson_chorus(3), thrill_seeker(19)
4:32.276 aoe o arcane_explosion Fluffy_Pillow 54440.5/67366: 81% mana arcane_charge(2), rune_of_power, thrill_seeker(20)
4:33.577 aoe o arcane_explosion Fluffy_Pillow 51193.3/67366: 76% mana arcane_charge(3), rune_of_power, thrill_seeker(20)
4:34.877 aoe p arcane_barrage Fluffy_Pillow 47944.9/67366: 71% mana arcane_charge(4), rune_of_power, thrill_seeker(21)
4:36.176 aoe o arcane_explosion Fluffy_Pillow 52389.6/67366: 78% mana rune_of_power, thrill_seeker(22)
4:37.475 aoe o arcane_explosion Fluffy_Pillow 49139.8/67366: 73% mana arcane_charge, rune_of_power, thrill_seeker(22)
4:38.774 aoe o arcane_explosion Fluffy_Pillow 45890.0/67366: 68% mana arcane_charge(2), clearcasting, rune_of_power, thrill_seeker(23)
4:40.073 aoe o arcane_explosion Fluffy_Pillow 47640.1/67366: 71% mana arcane_charge(3), rune_of_power, thrill_seeker(24)
4:41.373 aoe p arcane_barrage Fluffy_Pillow 44391.6/67366: 66% mana arcane_charge(4), thrill_seeker(24)
4:42.673 aoe n arcane_orb Fluffy_Pillow 48837.8/67366: 72% mana thrill_seeker(25)
4:43.972 aoe p arcane_barrage Fluffy_Pillow 50087.9/67366: 74% mana arcane_charge(4), thrill_seeker(25)
4:45.271 aoe o arcane_explosion Fluffy_Pillow 54532.7/67366: 81% mana thrill_seeker(26)
4:46.569 aoe o arcane_explosion Fluffy_Pillow 51281.5/67366: 76% mana arcane_charge, thrill_seeker(27)
4:47.868 aoe o arcane_explosion Fluffy_Pillow 48031.7/67366: 71% mana arcane_charge(2), thrill_seeker(27)
4:49.165 aoe o arcane_explosion Fluffy_Pillow 44779.2/67366: 66% mana arcane_charge(3), thrill_seeker(28)
4:50.466 aoe p arcane_barrage Fluffy_Pillow 41532.0/67366: 62% mana arcane_charge(4), thrill_seeker(29)
4:51.765 aoe o arcane_explosion Fluffy_Pillow 45976.8/67366: 68% mana thrill_seeker(29)
4:53.064 aoe o arcane_explosion Fluffy_Pillow 42727.0/67366: 63% mana arcane_charge, clearcasting, thrill_seeker(30)
4:54.365 aoe o arcane_explosion Fluffy_Pillow 44479.8/67366: 66% mana arcane_charge(2), thrill_seeker(31)
4:55.663 aoe o arcane_explosion Fluffy_Pillow 41228.6/67366: 61% mana arcane_charge(3), thrill_seeker(31)
4:56.964 aoe p arcane_barrage Fluffy_Pillow 37981.5/67366: 56% mana arcane_charge(4), thrill_seeker(32)
4:58.263 aoe o arcane_explosion Fluffy_Pillow 42426.3/67366: 63% mana thrill_seeker(33)
4:59.564 aoe o arcane_explosion Fluffy_Pillow 39179.1/67366: 58% mana arcane_charge, thrill_seeker(33)
5:00.862 aoe o arcane_explosion Fluffy_Pillow 35928.0/67366: 53% mana arcane_charge(2), thrill_seeker(34)
5:02.161 shared_cds u time_warp Fluffy_Pillow 32678.1/67366: 49% mana arcane_charge(3), thrill_seeker(35)
5:02.161 aoe o arcane_explosion Fluffy_Pillow 30678.1/67366: 46% mana arcane_charge(3), temporal_warp, thrill_seeker(35)
5:03.162 aoe p arcane_barrage Fluffy_Pillow 27026.8/67366: 40% mana arcane_charge(4), temporal_warp, crimson_chorus, thrill_seeker(35)
5:04.163 aoe n arcane_orb Fluffy_Pillow 31070.1/67366: 46% mana temporal_warp, crimson_chorus, thrill_seeker(36)
5:05.164 aoe p arcane_barrage Fluffy_Pillow 31918.7/67366: 47% mana arcane_charge(4), temporal_warp, crimson_chorus, thrill_seeker(36)
5:06.165 aoe o arcane_explosion Fluffy_Pillow 35962.0/67366: 53% mana temporal_warp, crimson_chorus, thrill_seeker(37)
5:07.165 aoe o arcane_explosion Fluffy_Pillow 32309.3/67366: 48% mana arcane_charge, clearcasting, temporal_warp, crimson_chorus, thrill_seeker(37)
5:08.165 aoe o arcane_explosion Fluffy_Pillow 33656.7/67366: 50% mana arcane_charge(2), temporal_warp, crimson_chorus, thrill_seeker(38)
5:09.163 aoe o arcane_explosion Fluffy_Pillow 30001.3/67366: 45% mana arcane_charge(3), temporal_warp, crimson_chorus, thrill_seeker(38)
5:10.163 aoe p arcane_barrage Fluffy_Pillow 26348.6/67366: 39% mana arcane_charge(4), temporal_warp, crimson_chorus, thrill_seeker(39)
5:11.163 aoe o arcane_explosion Fluffy_Pillow 30390.5/67366: 45% mana temporal_warp, crimson_chorus, thrill_seeker(39)
5:12.162 aoe o arcane_explosion Fluffy_Pillow 26736.5/67366: 40% mana arcane_charge, clearcasting, temporal_warp, crimson_chorus(2), euphoria
5:12.998 aoe j mirrors_of_torment Fluffy_Pillow 27862.9/67366: 41% mana arcane_charge(2), temporal_warp, crimson_chorus(2), euphoria
5:13.832 aoe k touch_of_the_magi Fluffy_Pillow 26986.5/67366: 40% mana arcane_charge(2), temporal_warp, crimson_chorus(2), euphoria
5:14.668 aoe m rune_of_power Fluffy_Pillow 25612.9/67366: 38% mana arcane_charge(4), temporal_warp, crimson_chorus(2), thrill_seeker, euphoria
5:15.503 aoe p arcane_barrage Fluffy_Pillow 29432.5/67366: 44% mana arcane_charge(4), rune_of_power, temporal_warp, crimson_chorus(2), thrill_seeker, euphoria
5:16.337 aoe o arcane_explosion Fluffy_Pillow 33250.8/67366: 49% mana rune_of_power, temporal_warp, crimson_chorus(2), thrill_seeker(3), euphoria
5:17.171 aoe o arcane_explosion Fluffy_Pillow 29374.5/67366: 44% mana arcane_charge, rune_of_power, temporal_warp, crimson_chorus(2), thrill_seeker(3), euphoria
5:18.005 aoe o arcane_explosion Fluffy_Pillow 25498.1/67366: 38% mana arcane_charge(2), rune_of_power, temporal_warp, crimson_chorus(2), thrill_seeker(4), euphoria
5:18.839 aoe o arcane_explosion Fluffy_Pillow 21621.8/67366: 32% mana arcane_charge(3), clearcasting, rune_of_power, temporal_warp, crimson_chorus(2), thrill_seeker(4), euphoria
5:19.676 aoe p arcane_barrage Fluffy_Pillow 22749.5/67366: 34% mana arcane_charge(4), rune_of_power, temporal_warp, crimson_chorus(2), thrill_seeker(4), euphoria
5:20.509 aoe o arcane_explosion Fluffy_Pillow 26566.4/67366: 39% mana rune_of_power, temporal_warp, crimson_chorus(2), thrill_seeker(5), euphoria
5:21.343 aoe o arcane_explosion Fluffy_Pillow 25384.7/67366: 38% mana arcane_charge, rune_of_power, temporal_warp, crimson_chorus(2), thrill_seeker(5), euphoria
5:22.179 aoe o arcane_explosion Fluffy_Pillow 21511.1/67366: 32% mana arcane_charge(2), rune_of_power, temporal_warp, crimson_chorus(3), thrill_seeker(6)
5:23.179 aoe o arcane_explosion Fluffy_Pillow 17858.4/67366: 27% mana arcane_charge(3), rune_of_power, temporal_warp, crimson_chorus(3), thrill_seeker(6)
5:24.180 aoe p arcane_barrage Fluffy_Pillow 14207.0/67366: 21% mana arcane_charge(4), rune_of_power, temporal_warp, crimson_chorus(3), thrill_seeker(7)
5:25.181 aoe n arcane_orb Fluffy_Pillow 18250.3/67366: 27% mana rune_of_power, temporal_warp, crimson_chorus(3), thrill_seeker(7)
5:26.183 aoe p arcane_barrage Fluffy_Pillow 19100.3/67366: 28% mana arcane_charge(4), rune_of_power, temporal_warp, crimson_chorus(3), thrill_seeker(8)
5:27.183 aoe o arcane_explosion Fluffy_Pillow 23142.3/67366: 34% mana rune_of_power, temporal_warp, crimson_chorus(3), thrill_seeker(8)
5:28.184 aoe o arcane_explosion Fluffy_Pillow 22185.6/67366: 33% mana arcane_charge, temporal_warp, crimson_chorus(3), thrill_seeker(9)
5:29.185 aoe o arcane_explosion Fluffy_Pillow 18534.2/67366: 28% mana arcane_charge(2), temporal_warp, crimson_chorus(3), thrill_seeker(9)
5:30.186 aoe o arcane_explosion Fluffy_Pillow 14882.9/67366: 22% mana arcane_charge(3), temporal_warp, crimson_chorus(3), thrill_seeker(10)
5:31.186 aoe p arcane_barrage Fluffy_Pillow 11230.2/67366: 17% mana arcane_charge(4), temporal_warp, crimson_chorus(3), thrill_seeker(10)
5:32.187 aoe o arcane_explosion Fluffy_Pillow 15273.5/67366: 23% mana temporal_warp, thrill_seeker(11)
5:33.187 aoe o arcane_explosion Fluffy_Pillow 11620.8/67366: 17% mana arcane_charge, temporal_warp, thrill_seeker(11)
5:34.187 aoe o arcane_explosion Fluffy_Pillow 7968.1/67366: 12% mana arcane_charge(2), temporal_warp, thrill_seeker(12)
5:35.188 aoe q evocation Fluffy_Pillow 4316.8/67366: 6% mana arcane_charge(3), temporal_warp, thrill_seeker(12)
5:38.511 aoe o arcane_explosion Fluffy_Pillow 61537.0/67366: 91% mana arcane_charge(3), temporal_warp, thrill_seeker(14)
5:39.513 aoe p arcane_barrage Fluffy_Pillow 57887.0/67366: 86% mana arcane_charge(4), clearcasting, temporal_warp, thrill_seeker(14)
5:40.512 aoe o arcane_explosion Fluffy_Pillow 61927.6/67366: 92% mana clearcasting, temporal_warp, thrill_seeker(15)
5:41.512 aoe o arcane_explosion Fluffy_Pillow 63274.9/67366: 94% mana arcane_charge, temporal_warp, thrill_seeker(15)
5:42.513 aoe o arcane_explosion Fluffy_Pillow 59623.6/67366: 89% mana arcane_charge(2), thrill_seeker(16)
5:43.814 aoe o arcane_explosion Fluffy_Pillow 56376.4/67366: 84% mana arcane_charge(3), thrill_seeker(16)
5:45.113 aoe p arcane_barrage Fluffy_Pillow 53126.6/67366: 79% mana arcane_charge(4), thrill_seeker(17)
5:46.411 aoe n arcane_orb Fluffy_Pillow 57570.0/67366: 85% mana thrill_seeker(18)
5:47.710 aoe p arcane_barrage Fluffy_Pillow 58820.2/67366: 87% mana arcane_charge(4), thrill_seeker(18)
5:49.008 aoe o arcane_explosion Fluffy_Pillow 63263.6/67366: 94% mana thrill_seeker(19)
5:50.309 aoe o arcane_explosion Fluffy_Pillow 60016.5/67366: 89% mana arcane_charge, thrill_seeker(20)

Stats

Level Bonus (60) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 198 1 199 199 0
Agility 306 2 308 308 0
Stamina 414 0 2013 1918 1504
Intellect 450 -3 1767 1588 1066 (46)
Spirit 0 0 0 0 0
Health 40260 38360 0
Mana 67366 67366 0
Spell Power 1767 1588 0
Crit 15.74% 15.74% 376
Haste 15.76% 15.76% 520
Versatility 7.97% 7.97% 319
Mana Regen 1347 1347 0
Mastery 34.73% 34.73% 733
Armor 369 369 369
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 227.00
Local Head Confidant's Favored Cap
ilevel: 226, stats: { 44 Armor, +82 Int, +149 Sta, +44 Haste, +98 Mastery }
Local Neck Noble's Birthstone Pendant
ilevel: 226, stats: { +84 Sta, +52 Crit, +162 Mastery }
Local Shoulders Shawl of the Penitent
ilevel: 233, stats: { 42 Armor, +65 Int, +122 Sta, +33 Crit, +76 Haste }
Local Chest Robes of the Cursed Commando
ilevel: 233, stats: { 61 Armor, +87 Int, +162 Sta, +47 Crit, +100 Haste }, enchant: { +20 Int }
Local Waist Cinch of Infinite Tightness
ilevel: 226, stats: { 33 Armor, +61 Int, +112 Sta, +69 Crit, +36 Vers }
Local Legs Courtier's Costume Trousers
ilevel: 226, stats: { 51 Armor, +82 Int, +149 Sta, +49 Vers, +93 Mastery }
Local Feet Slippers of the Forgotten Heretic
ilevel: 226, stats: { 36 Armor, +61 Int, +112 Sta, +73 Crit, +32 Mastery }
Local Wrists Acolyte's Velvet Bindings
ilevel: 226, stats: { 29 Armor, +46 Int, +84 Sta, +26 Vers, +53 Mastery }, enchant: { +15 Int }
Local Hands Impossibly Oversized Mitts
ilevel: 226, stats: { 33 Armor, +61 Int, +112 Sta, +31 Haste, +74 Mastery }
Local Finger1 Most Regal Signet of Sire Denathrius
ilevel: 233, stats: { +91 Sta, +178 Haste, +48 Mastery }, enchant: { +16 Mastery }
item effects: { equip: Denathrius' Privilege }
Local Finger2 Shadowghast Ring
ilevel: 235, stats: { +94 Sta, +115 Mastery, +115 Vers }, enchant: { +16 Mastery }
item effects: { equip: Temporal Warp }
Local Trinket1 Cabalist's Hymnal
ilevel: 226, stats: { +77 Int }
item effects: { equip: Crimson Chorus }
Local Trinket2 Sinful Aspirant's Badge of Ferocity
ilevel: 207, stats: { +91 Haste }
item effects: { use: Gladiator's Badge }
Local Back Mantle of Manifest Sins
ilevel: 226, stats: { 40 Armor, +84 Sta, +53 Crit, +26 Mastery, +46 StrAgiInt }
Local Main Hand Staff of the Penitent
ilevel: 226, weapon: { 93 - 128, 3.6 }, stats: { +82 Int, +281 Int, +149 Sta, +49 Crit, +93 Vers }, enchant: sinful_revelation

Profile

mage="Venthyr_Nadjia"
source=default
spec=arcane
level=60
race=troll
role=spell
position=back
talents=1031021
talent_override=resonance,if=3>2
covenant=venthyr
soulbind=331586//arcane_prodigy:6//51:6

# Default consumables
potion=deathly_fixation
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=variable,name=prepull_evo,op=reset,default=0
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
actions.precombat+=/variable,name=have_opened,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
actions.precombat+=/variable,name=final_burn,op=set,value=0
actions.precombat+=/variable,name=rs_max_delay,op=reset,default=5
actions.precombat+=/variable,name=ap_max_delay,op=reset,default=10
actions.precombat+=/variable,name=rop_max_delay,op=reset,default=20
actions.precombat+=/variable,name=totm_max_delay,op=reset,default=5
actions.precombat+=/variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
actions.precombat+=/variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
actions.precombat+=/variable,name=barrage_mana_pct,op=reset,default=70
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=reset,default=30
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
actions.precombat+=/variable,name=totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=aoe_totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=am_spam,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
actions.precombat+=/variable,name=am_spam_evo_pct,op=reset,default=15
actions.precombat+=/flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_familiar
actions.precombat+=/arcane_intellect
actions.precombat+=/conjure_mana_gem
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/frostbolt,if=variable.prepull_evo<=0
actions.precombat+=/evocation,if=variable.prepull_evo>0

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/call_action_list,name=shared_cds
actions+=/call_action_list,name=essences
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/call_action_list,name=opener,if=variable.have_opened<=0
actions+=/call_action_list,name=am_spam,if=variable.am_spam=1
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=rotation,if=variable.final_burn=0
actions+=/call_action_list,name=final_burn,if=variable.final_burn=1
actions+=/call_action_list,name=movement

actions.am_spam=cancel_action,if=action.evocation.channeling&mana.pct>=95
actions.am_spam+=/evocation,if=mana.pct<=variable.am_spam_evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/rune_of_power,if=buff.rune_of_power.down&cooldown.arcane_power.remains>0
actions.am_spam+=/touch_of_the_magi,if=(cooldown.arcane_power.remains=0&buff.rune_of_power.down)|prev_gcd.1.rune_of_power
actions.am_spam+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&buff.rune_of_power.down&essence.vision_of_perfection.enabled
actions.am_spam+=/arcane_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.ap_max_delay
actions.am_spam+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=action.arcane_missiles.execute_time&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_barrage,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_missiles,if=buff.clearcasting.react,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/arcane_missiles,if=!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.am_spam+=/arcane_barrage
actions.am_spam+=/arcane_blast

actions.aoe=frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
actions.aoe+=/arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
actions.aoe+=/mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
actions.aoe+=/arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
actions.aoe+=/rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
actions.aoe+=/presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
actions.aoe+=/arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
actions.aoe+=/supernova
actions.aoe+=/arcane_orb,if=buff.arcane_charge.stack=0
actions.aoe+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
actions.aoe+=/arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1

# Prioritize using grisly icicle with ap. Use it with totm otherwise.
actions.cooldowns=frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.cooldowns+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
# Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
# Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
actions.cooldowns+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
# Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
# Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
# Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
actions.cooldowns+=/arcane_power,if=(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
actions.cooldowns+=/rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
# Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
actions.cooldowns+=/presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
# Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.cooldowns+=/presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled

actions.essences=blood_of_the_enemy,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/blood_of_the_enemy,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains>=50&cooldown.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay
actions.essences+=/worldvein_resonance,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/guardian_of_azeroth,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/guardian_of_azeroth,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/concentrated_flame,line_cd=6,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/reaping_flames,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/focused_azerite_beam,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/purifying_blast,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/ripple_in_space,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/the_unbound_force,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/memory_of_lucid_dreams,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down

actions.final_burn=arcane_missiles,if=buff.clearcasting.react,chain=1
actions.final_burn+=/arcane_blast
actions.final_burn+=/arcane_barrage

actions.movement=blink_any,if=movement.distance>=10
actions.movement+=/presence_of_mind
actions.movement+=/arcane_missiles,if=movement.distance<10
actions.movement+=/arcane_orb
actions.movement+=/fire_blast

actions.opener=variable,name=have_opened,op=set,value=1,if=prev_gcd.1.evocation
actions.opener+=/fire_blast,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command_frost.up
actions.opener+=/frost_nova,if=runeforge.grisly_icicle.equipped&mana.pct>95
actions.opener+=/mirrors_of_torment
actions.opener+=/deathborne
actions.opener+=/radiant_spark,if=mana.pct>40
actions.opener+=/cancel_action,if=action.shifting_power.channeling&gcd.remains=0
actions.opener+=/shifting_power,if=soulbind.field_of_blossoms.enabled
actions.opener+=/touch_of_the_magi
actions.opener+=/arcane_power
actions.opener+=/rune_of_power,if=buff.rune_of_power.down
actions.opener+=/presence_of_mind
actions.opener+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.opener+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.opener+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.opener+=/arcane_missiles,if=buff.clearcasting.react,chain=1
actions.opener+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges&(cooldown.arcane_power.remains>10|active_enemies<=2)
actions.opener+=/arcane_blast,if=buff.rune_of_power.up|mana.pct>15
actions.opener+=/evocation,if=buff.rune_of_power.down,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.opener+=/arcane_barrage

actions.rotation=variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
actions.rotation+=/strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
actions.rotation+=/arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
actions.rotation+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.rotation+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.rotation+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
actions.rotation+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
actions.rotation+=/supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.rotation+=/arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
actions.rotation+=/arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_blast
actions.rotation+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.rotation+=/arcane_barrage

actions.shared_cds=use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
actions.shared_cds+=/use_items,if=buff.arcane_power.up
actions.shared_cds+=/potion,if=buff.arcane_power.up
actions.shared_cds+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
actions.shared_cds+=/lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/berserking,if=buff.arcane_power.up
actions.shared_cds+=/blood_fury,if=buff.arcane_power.up
actions.shared_cds+=/fireblood,if=buff.arcane_power.up
actions.shared_cds+=/ancestral_call,if=buff.arcane_power.up

head=confidants_favored_cap,id=183021,bonus_id=1498,ilevel=226
neck=nobles_birthstone_pendant,id=183039,bonus_id=1498,ilevel=226
shoulders=shawl_of_the_penitent,id=183020,bonus_id=1498,ilevel=233
back=mantle_of_manifest_sins,id=183033,bonus_id=1498,ilevel=226
chest=robes_of_the_cursed_commando,id=182998,bonus_id=1498,ilevel=233,enchant=eternal_insight
wrists=acolytes_velvet_bindings,id=183017,bonus_id=1498,ilevel=226,enchant=eternal_intellect
hands=impossibly_oversized_mitts,id=183022,bonus_id=1498,ilevel=226
waist=cinch_of_infinite_tightness,id=183028,bonus_id=1498,ilevel=226
legs=courtiers_costume_trousers,id=183011,bonus_id=1498,ilevel=226
feet=slippers_of_the_forgotten_heretic,id=182979,bonus_id=1498,ilevel=226
finger1=most_regal_signet_of_sire_denathrius,id=183036,bonus_id=1498,ilevel=233,enchant=16mastery
finger2=shadowghast_ring,id=178926,bonus_id=6648/6650/6758/6834/1532,ilevel=235,enchant=16mastery
trinket1=cabalists_hymnal,id=184028,bonus_id=1498,ilevel=226
trinket2=sinful_aspirants_badge_of_ferocity,id=175884,bonus_id=1521,ilevel=207
main_hand=staff_of_the_penitent,id=180000,bonus_id=7187/6652/1524,ilevel=226,enchant=sinful_revelation

# Gear Summary
# gear_ilvl=226.73
# gear_stamina=1504
# gear_intellect=1066
# gear_crit_rating=376
# gear_haste_rating=520
# gear_mastery_rating=733
# gear_versatility_rating=319
# gear_armor=369

Venthyr_Theotar : 8683 dps, 3740 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
8682.7 8682.7 11.5 / 0.132% 843.1 / 9.7% 3.9
RPS Out RPS In Primary Resource Waiting APM Active Skill
2218.6 2122.2 Mana 0.00% 53.5 100.0% 100%
Talents
Venthyr
Runeforge

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Venthyr_Theotar 8683
Arcane Barrage 3237 37.3% 60.2 4.99sec 16134 13764 Direct 180.2 4517 9176 5388 18.7%

Stats Details: Arcane Barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 60.17 180.22 0.00 0.00 1.1722 0.0000 970713.86 970713.86 0.00% 13763.91 13763.91
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.32% 146.55 108 185 4517.15 2155 15537 4520.12 4097 4959 661912 661912 0.00%
crit 18.68% 33.67 17 65 9176.09 4309 31073 9183.25 6607 12749 308802 308802 0.00%

Action Details: Arcane Barrage

  • id:44425
  • school:arcane
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.728000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=0 + 72.8%} Arcane damage. For each Arcane Charge, deals {$36032s2=30}% additional damage$?a321526[, grants you {$321526s1=2}% of your maximum mana,][]$?a231564[ and hits {$36032s3=0} additional nearby $Ltarget:targets; for {$s2=40}% of its damage][]. |cFFFFFFFFConsumes all Arcane Charges.|r

Action Priority List

    aoe
    [p]:60.15
  • if_expr:buff.arcane_charge.stack=buff.arcane_charge.max_stack
Arcane Explosion 3872 44.6% 165.4 1.79sec 7021 6037 Direct 496.2 1956 4018 2341 18.7%

Stats Details: Arcane Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 165.41 496.23 0.00 0.00 1.1631 0.0000 1161373.77 1161373.77 0.00% 6036.78 6036.78
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.34% 403.63 308 508 1956.07 1427 4286 1956.90 1856 2089 789382 789382 0.00%
crit 18.66% 92.60 55 141 4017.71 2855 8572 4018.80 3428 4626 371991 371991 0.00%

Action Details: Arcane Explosion

  • id:1449
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.502320
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s2=0 + 50.2%} Arcane damage to all enemies within $A2 yards.$?a137021[ |cFFFFFFFFGenerates {$s1=1} Arcane Charge if any targets are hit.|r][]

Action Priority List

    aoe
    [o]:165.39
  • if_expr:buff.arcane_charge.stack<buff.arcane_charge.max_stack
Arcane Orb 0 (666) 0.0% (7.7%) 13.3 23.20sec 14996 12547

Stats Details: Arcane Orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.32 0.00 0.00 0.00 1.1952 0.0000 0.00 0.00 0.00% 12546.99 12546.99

Action Details: Arcane Orb

  • id:153626
  • school:arcane
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:153626
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r

Action Priority List

    aoe
    [n]:13.31
  • if_expr:buff.arcane_charge.stack=0
    Arcane Orb (_bolt) 666 7.7% 39.9 23.20sec 5004 0 Direct 39.9 4189 8646 5005 18.3%

Stats Details: Arcane Orb Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.91 39.91 0.00 0.00 0.0000 0.0000 199697.90 199697.90 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.67% 32.59 22 46 4188.86 2821 8470 4189.01 3233 4716 136465 136465 0.00%
crit 18.33% 7.32 0 15 8646.47 5642 16940 8623.67 0 12756 63232 63232 0.00%

Action Details: Arcane Orb Bolt

  • id:153640
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.092000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:153640
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:{$@spelldesc153626=Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r}
Deathly Fixation 0 (86) 0.0% (1.0%) 18.6 1.36sec 1376 0

Stats Details: Deathly Fixation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.59 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Deathly Fixation

  • id:322253
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:42.90
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322253
  • name:Deathly Fixation
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1.
  • description:Deal {$s1=43} Shadow damage every $t1. Stacks up to 5 times.
    Deathly Eruption 86 1.0% 18.6 1.36sec 1376 0 Direct 18.6 1138 2278 1375 20.8%

Stats Details: Deathly Eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.59 18.59 0.00 0.00 0.0000 0.0000 25566.46 25566.46 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.15% 14.71 6 24 1138.05 1117 1184 1137.98 1117 1180 16741 16741 0.00%
crit 20.85% 3.87 0 11 2277.68 2233 2367 2242.62 0 2367 8825 8825 0.00%

Action Details: Deathly Eruption

  • id:322256
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:984.99
  • base_dd_max:984.99
  • base_dd_mult:1.00

Spelldata

  • id:322256
  • name:Deathly Eruption
  • school:shadow
  • tooltip:
  • description:Deal {$s1=985} Shadow damage.
Eternal Insight 39 0.5% 21.5 13.67sec 551 0 Direct 21.5 464 928 551 18.7%

Stats Details: Eternal Insight

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 21.49 21.49 0.00 0.00 0.0000 0.0000 11843.76 11843.76 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.31% 17.48 5 31 464.32 453 481 464.28 453 476 8114 8114 0.00%
crit 18.69% 4.02 0 12 928.33 907 961 913.60 0 961 3729 3729 0.00%

Action Details: Eternal Insight

  • id:342314
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:400.00
  • base_dd_max:400.00
  • base_dd_mult:1.00

Spelldata

  • id:342314
  • name:Eternal Insight
  • school:shadow
  • tooltip:
  • description:Deals {$s1=400} Shadow damage.
Frostbolt 4 0.0% 0.0 0.00sec 0 0 Direct 1.0 1024 2047 1195 16.8%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 1.00 0.00 0.00 0.0000 0.0000 1195.99 1195.99 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.17% 0.83 0 1 1023.69 1024 1024 851.40 0 1024 851 851 0.00%
crit 16.83% 0.17 0 1 2047.39 2047 2047 344.59 0 2047 345 345 0.00%

Action Details: Frostbolt

  • id:116
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.511000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116
  • name:Frostbolt
  • school:frost
  • tooltip:
  • description:Launches a bolt of frost at the enemy, causing {$228597s1=0} Frost damage and slowing movement speed by {$205708s1=50}% for {$205708d=8 seconds}.
Mirror Image 0 (19) 0.0% (0.2%) 1.0 0.00sec 5754 0

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.
    Frostbolt (mirror_image) 144  / 19 0.2% 117.0 0.99sec 49 49 Direct 117.0 41 83 49 19.9%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 117.00 117.00 0.00 0.00 1.0091 0.0000 5754.28 5754.28 0.00% 48.74 48.74
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.11% 93.73 80 105 40.86 30 51 40.86 40 42 3830 3830 0.00%
crit 19.89% 23.27 12 37 82.70 59 101 82.69 72 92 1924 1924 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:40.00
Mirrors of Torment 0 (111) 0.0% (1.3%) 2.8 131.32sec 11767 9056

Stats Details: Mirrors Of Torment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.85 0.00 0.00 0.00 1.2995 0.0000 0.00 0.00 0.00% 9055.95 9055.95

Action Details: Mirrors Of Torment

  • id:314793
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:314793
  • name:Mirrors of Torment
  • school:shadow
  • tooltip:Attacking, casting a spell or ability, consumes a mirror to inflict Shadow damage and reduce cast and movement speed by {$320035s3=15}%. Your final mirror will instead Root and Silence you for {$317589d=4 seconds}.
  • description:Conjure $n mirrors to torment the enemy for {$d=25 seconds}. Whenever the target attacks, casts a spell, or uses an ability, a mirror is consumed to inflict {$320035s1=0} Shadow damage and their movement and cast speed are slowed by {$320035s3=15}%. This effect cannot be triggered more often than once per {$345977d=6 seconds}. The final mirror will instead inflict {$317589s1=0} Shadow damage to the enemy, Rooting and Silencing them for {$317589d=4 seconds}. Whenever a mirror is consumed $?c1[you gain {$345417s1=4}% mana][]$?c2[your Fire Blast cooldown is reduced by {$s2=4} sec][]$?c3[you gain Brain Freeze][].

Action Priority List

    aoe
    [j]:2.86
  • if_expr:(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
    Agonizing Backlash 56 0.6% 5.6 53.17sec 2994 0 Direct 5.6 2508 5090 2995 18.9%

Stats Details: Agonizing Backlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.63 5.63 0.00 0.00 0.0000 0.0000 16870.65 16870.65 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.12% 4.57 1 6 2507.70 1202 3246 2494.10 1202 3185 11462 11462 0.00%
crit 18.88% 1.06 0 4 5089.57 2404 6493 3510.06 0 6493 5409 5409 0.00%

Action Details: Agonizing Backlash

  • id:320035
  • school:shadow
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:320035
  • name:Agonizing Backlash
  • school:shadow
  • tooltip:Movement speed and cast speed slowed by {$s3=15}%.
  • description:{$@spelldesc314793=Conjure $n mirrors to torment the enemy for {$d=25 seconds}. Whenever the target attacks, casts a spell, or uses an ability, a mirror is consumed to inflict {$320035s1=0} Shadow damage and their movement and cast speed are slowed by {$320035s3=15}%. This effect cannot be triggered more often than once per {$345977d=6 seconds}. The final mirror will instead inflict {$317589s1=0} Shadow damage to the enemy, Rooting and Silencing them for {$317589d=4 seconds}. Whenever a mirror is consumed $?c1[you gain {$345417s1=4}% mana][]$?c2[your Fire Blast cooldown is reduced by {$s2=4} sec][]$?c3[you gain Brain Freeze][].}
    Tormenting Backlash 55 0.6% 2.7 132.92sec 6048 0 Direct 2.7 5025 10276 6044 19.5%

Stats Details: Tormenting Backlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.75 2.75 0.00 0.00 0.0000 0.0000 16627.32 16627.32 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.50% 2.21 0 3 5024.51 4235 5836 4927.36 0 5506 11117 11117 0.00%
crit 19.50% 0.54 0 3 10276.30 8470 11011 4588.96 0 11011 5511 5511 0.00%

Action Details: Tormenting Backlash

  • id:317589
  • school:shadow
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.510000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:317589
  • name:Tormenting Backlash
  • school:shadow
  • tooltip:Rooted and Silenced.
  • description:{$@spelldesc314793=Conjure $n mirrors to torment the enemy for {$d=25 seconds}. Whenever the target attacks, casts a spell, or uses an ability, a mirror is consumed to inflict {$320035s1=0} Shadow damage and their movement and cast speed are slowed by {$320035s3=15}%. This effect cannot be triggered more often than once per {$345977d=6 seconds}. The final mirror will instead inflict {$317589s1=0} Shadow damage to the enemy, Rooting and Silencing them for {$317589d=4 seconds}. Whenever a mirror is consumed $?c1[you gain {$345417s1=4}% mana][]$?c2[your Fire Blast cooldown is reduced by {$s2=4} sec][]$?c3[you gain Brain Freeze][].}
Touch of the Magi 0 (647) 0.0% (7.5%) 6.1 52.15sec 31558 26332

Stats Details: Touch Of The Magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.15 0.00 0.00 0.00 1.1985 0.0000 0.00 0.00 0.00% 26332.00 26332.00

Action Details: Touch Of The Magi

  • id:321507
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:4.0

Spelldata

  • id:321507
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]

Action Priority List

    aoe
    [k]:6.16
  • if_expr:buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
    Touch of the Magi (_explosion) 647 7.5% 6.1 52.08sec 31558 0 Direct 18.4 10554 0 10554 0.0%

Stats Details: Touch Of The Magi Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.15 18.39 0.00 0.00 0.0000 0.0000 194040.49 194040.49 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 18.39 15 21 10554.29 601 45547 10535.77 7875 13666 194040 194040 0.00%

Action Details: Touch Of The Magi Explosion

  • id:210833
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:11904.46
  • base_dd_max:11904.46
  • base_dd_mult:1.00

Spelldata

  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc321507=Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]}
Simple Action Stats Execute Interval
Venthyr_Theotar
Arcane Power 2.8 128.59sec

Stats Details: Arcane Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.84 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Power

  • id:12042
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].

Action Priority List

    aoe
    [l]:2.84
  • if_expr:((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
Berserking 1.8 257.25sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.84 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    shared_cds
    [v]:1.84
  • if_expr:buff.arcane_power.up
Conjure Mana Gem 1.0 0.00sec

Stats Details: Conjure Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Conjure Mana Gem

  • id:759
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:9000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:759
  • name:Conjure Mana Gem
  • school:arcane
  • tooltip:
  • description:Conjures a Mana Gem that can be used to instantly restore {$5405s1=10}% mana, and holds up to {$s2=3} charges. $@spellname118812 {$@spelldesc118812=Conjured items disappear if logged out for more than 15 minutes.}
Evocation 0.8 262.76sec

Stats Details: Evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.79 0.00 4.69 0.00 4.1956 0.7062 0.00 0.00 0.00% 0.00 0.00

Action Details: Evocation

  • id:12051
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Venthyr_Theotar
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.

Action Priority List

    aoe
    [q]:0.79
  • interrupt_if_expr:mana.pct>=85
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Venthyr_Theotar
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Venthyr_Theotar
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Deathly Fixation (potion) 1.0 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307497
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    shared_cds
    [t]:1.00
  • if_expr:buff.arcane_power.up
Rune of Power 6.0 51.03sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.01 0.00 0.00 0.00 1.1967 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    aoe
    [m]:6.03
  • if_expr:buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Time Warp 1.5 300.21sec

Stats Details: Time Warp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.49 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Time Warp

  • id:80353
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:2000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:80353
  • name:Time Warp
  • school:arcane
  • tooltip:Haste increased by $w1%. $?$W4>0[Time rate increased by $w4%.][]$?$W3=1[ When the effect ends, you die.][]
  • description:Warp the flow of time, increasing haste by {$s1=30}% $?a320919[and time rate by {$s4=0}% ][]for all party and raid members for {$d=40 seconds}. Allies will be unable to benefit from Bloodlust, Heroism, or Time Warp again for {$57724d=600 seconds}.$?a320920[ When the effect ends, you die.][]

Action Priority List

    shared_cds
    [u]:1.49
  • if_expr:runeforge.temporal_warp.equipped&buff.exhaustion.up
Replenish Mana (use_mana_gem) 2.7 125.79sec

Stats Details: Use Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.74 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Use Mana Gem

  • id:5405
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Venthyr_Theotar
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5405
  • name:Replenish Mana
  • school:physical
  • tooltip:Restoring $w2 mana every $t1 sec.
  • description:Restores {$s1=10}% mana.

Action Priority List

    shared_cds
    [r]:2.74
  • if_expr:(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Arcane Charge 60.9 163.9 4.9sec 1.3sec 3.6sec 73.10% 0.00% 0.5 (0.6) 0.0

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.8s / 13.4s
  • trigger_min/max:0.0s / 8.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 9.5s

Stack Uptimes

  • arcane_charge_1:18.77%
  • arcane_charge_2:16.42%
  • arcane_charge_3:16.56%
  • arcane_charge_4:21.35%

Spelldata

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 2.8 0.0 128.5sec 128.5sec 14.7sec 13.92% 0.00% 0.0 (0.0) 2.7

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:122.3s / 134.3s
  • trigger_min/max:122.3s / 134.3s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 15.0s

Stack Uptimes

  • arcane_power_1:13.92%

Spelldata

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Berserking 1.8 0.0 257.2sec 257.2sec 11.7sec 7.14% 11.77% 0.0 (0.0) 1.8

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:254.8s / 261.4s
  • trigger_min/max:254.8s / 261.4s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 12.0s

Stack Uptimes

  • berserking_1:7.14%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.51% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.51%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Clearcasting 26.3 0.2 11.1sec 11.1sec 1.9sec 16.28% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_clearcasting
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • clearcasting_1:16.07%
  • clearcasting_2:0.21%
  • clearcasting_3:0.01%

Spelldata

  • id:263725
  • name:Clearcasting
  • tooltip:Your next Arcane Missiles or Arcane Explosion costs no mana{$?s321758=false}[ and Arcane Missiles fires an additional missile][].
  • description:{$@spelldesc79684=For each ${$c*100/{$s1=200}} mana you spend, you have a 1% chance to gain Clearcasting, making your next Arcane Missiles or Arcane Explosion free and channel {$277726s1=20}% faster.$?a321758[ Arcane Missiles fires {$321758s2=1} additional missile.][]}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Crimson Chorus 5.5 0.0 60.6sec 60.6sec 28.6sec 51.99% 0.00% 0.0 (0.0) 4.9

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_crimson_chorus
  • max_stacks:3
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:60.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:10.00
  • associated item:Cabalist's Hymnal

Stat Details

  • stat:crit_rating
  • amount:95.00

Trigger Details

  • interval_min/max:60.0s / 66.1s
  • trigger_min/max:60.0s / 66.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • crimson_chorus_1:17.93%
  • crimson_chorus_2:17.32%
  • crimson_chorus_3:16.74%

Spelldata

  • id:344803
  • name:Crimson Chorus
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc344806=Join the Crimson Chorus. Every minute, your Critical Strike swells by ${{$s1=44}*3} over ${{$344803d=10 seconds}*3} sec. before returning to normal. This effect is increased by {$s2=5}% for each member of the Crimson Chorus in your party.}
  • max_stacks:3
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Evocation 0.8 0.0 235.3sec 235.3sec 4.2sec 1.11% 0.00% 3.1 (3.1) 0.0

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_evocation
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:7.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:1.00

Trigger Details

  • interval_min/max:91.3s / 296.6s
  • trigger_min/max:91.3s / 296.6s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 4.3s

Stack Uptimes

  • evocation_1:1.11%

Spelldata

  • id:12051
  • name:Evocation
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Gladiator's Badge 2.8 0.0 128.5sec 128.5sec 14.7sec 13.92% 0.00% 0.0 (0.0) 2.7

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_gladiators_badge
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Sinful Aspirant's Badge of Ferocity

Stat Details

  • stat:intellect
  • amount:342.00

Trigger Details

  • interval_min/max:122.3s / 134.3s
  • trigger_min/max:122.3s / 134.3s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 15.0s

Stack Uptimes

  • gladiators_badge_1:13.92%

Spelldata

  • id:345228
  • name:Gladiator's Badge
  • tooltip:Primary stat increased by $w1.
  • description:Increases primary stat by {$s1=252} for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:0.00%
Potion of Deathly Fixation 1.0 0.0 0.0sec 0.0sec 25.0sec 8.45% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_potion_of_deathly_fixation
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:25.0s / 25.0s

Stack Uptimes

  • potion_of_deathly_fixation_1:8.45%

Spelldata

  • id:307497
  • name:Potion of Deathly Fixation
  • tooltip:Chance to apply Deathly Fixation to your target.
  • description:Your damaging spells and abilities have a chance to apply Deathly Fixation to your target, dealing {$322253s1=43} Shadow damage over {$322253d=8 seconds} and stacking up to 5 times. Upon reaching 5 stacks, Deathly Fixation explodes, dealing {$322256s1=985} Shadow damage to the target. If you consume this potion while your weapon is augmented with Shadowcore Oil, the explosion damage is increased by {$s2=10}%. Lasts {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Rune of Power 8.8 0.0 35.0sec 35.0sec 11.8sec 34.81% 0.00% 0.0 (0.0) 8.6

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.0s / 54.2s
  • trigger_min/max:13.0s / 54.2s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s

Stack Uptimes

  • rune_of_power_1:34.81%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Soothing Shade 4.1 0.0 62.9sec 62.9sec 11.8sec 16.15% 0.00% 0.0 (0.0) 4.0

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_soothing_shade
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:525.00

Trigger Details

  • interval_min/max:20.0s / 196.2s
  • trigger_min/max:20.0s / 196.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • soothing_shade_1:16.15%

Spelldata

  • id:336885
  • name:Soothing Shade
  • tooltip:Standing in the shade makes it easier to focus, increasing your Mastery by $w1.
  • description:{$@spelldesc336239=Your spells and abilities have a chance to call Tubbins and Gubbins to your side for {$336808d=12 seconds}, parasol in hand. Standing in the shaded area grants you {$336885s1=525} Mastery.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Temporal Warp 1.5 0.0 300.2sec 300.2sec 35.3sec 17.25% 0.00% 0.0 (0.0) 1.1

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_temporal_warp
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:300.0s / 300.9s
  • trigger_min/max:300.0s / 300.9s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 40.0s

Stack Uptimes

  • temporal_warp_1:17.25%

Spelldata

  • id:327355
  • name:Temporal Warp
  • tooltip:Haste increased by $w1%.
  • description:{$@spelldesc327351=While you have Temporal Displacement or other similar effects, you may use Time Warp to grant yourself {$327355s1=30}% Haste for {$327355d=40 seconds}.}
  • max_stacks:0
  • duration:40.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism)

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Benefit Avg % Min Max
Arcane Barrage Arcane Charge 4 100.00% 100.00% 100.00%
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 2.37% 0.43% 7.31% 0.8s 0.0s 6.0s
Conserve Phase 100.00% 100.00% 100.00% 299.9s 240.2s 360.0s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.0000.0000.000179.943120.203239.964
Evocation137.6561.301353.692239.171150.203353.802
Rune of Power6.4180.61721.81640.08522.90248.727
Touch of the Magi5.1750.89320.24333.38421.60347.822
Arcane Power6.2612.06414.30418.1767.00323.498
Arcane Barrage2.6390.0018.252159.823126.299194.146
Arcane Orb3.1710.00010.32142.43232.34957.336
Mirrors of Torment25.7080.00072.12874.00866.86586.079
Time Warp0.9470.0001.3031.4091.2962.234

Burn Phases

Burn phase duration tracks the amount of time spent in each burn phase. This is defined as the time between a start_burn_phase and stop_burn_phase action being executed. Note that "execute" burn phases, i.e., the final burn of a fight, is also included.

Burn Phase Duration
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Mana at burn start is the mana level recorded (in percentage of total mana) when a start_burn_phase command is executed.

Mana at Burn Start
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Venthyr_Theotar
mana_regen Mana 506.59 399608.73 62.77% 788.82 12263.79 2.98%
Evocation Mana 37.09 40688.55 6.39% 1097.05 0.00 0.00%
Mana Gem Mana 2.74 18821.15 2.96% 6866.97 0.00 0.00%
Arcane Barrage Mana 60.15 156873.22 24.64% 2607.88 8453.19 5.11%
Mirrors of Torment Mana 8.39 20609.38 3.24% 2456.13 2426.53 10.53%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 66365.7 2122.25 2218.65 23108.1 38011.8 230.2 67365.7
Usage Type Count Total Avg RPE APR
Venthyr_Theotar
arcane_explosion Mana 165.4 634393.3 3835.6 3835.3 1.8
arcane_orb Mana 13.3 5968.5 448.3 448.2 33.5
mirrors_of_torment Mana 2.8 5697.4 2000.0 2001.3 5.9
time_warp Mana 1.5 2972.3 2000.0 1992.1 0.0
touch_of_the_magi Mana 6.1 15367.0 2500.0 2499.3 12.6

Statistics & Data Analysis

Fight Length
Venthyr_Theotar Fight Length
Count 1319
Mean 299.94
Minimum 240.20
Maximum 359.96
Spread ( max - min ) 119.76
Range [ ( max - min ) / 2 * 100% ] 19.96%
DPS
Venthyr_Theotar Damage Per Second
Count 1319
Mean 8682.74
Minimum 7925.26
Maximum 9400.24
Spread ( max - min ) 1474.98
Range [ ( max - min ) / 2 * 100% ] 8.49%
Standard Deviation 213.1441
5th Percentile 8349.68
95th Percentile 9054.19
( 95th Percentile - 5th Percentile ) 704.51
Mean Distribution
Standard Deviation 5.8688
95.00% Confidence Interval ( 8671.24 - 8694.25 )
Normalized 95.00% Confidence Interval ( 99.87% - 100.13% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 24
0.1% Error 2315
0.1 Scale Factor Error with Delta=300 388
0.05 Scale Factor Error with Delta=300 1552
0.01 Scale Factor Error with Delta=300 38783
Priority Target DPS
Venthyr_Theotar Priority Target Damage Per Second
Count 1319
Mean 3739.68
Minimum 3388.72
Maximum 4224.77
Spread ( max - min ) 836.05
Range [ ( max - min ) / 2 * 100% ] 11.18%
Standard Deviation 128.2753
5th Percentile 3539.02
95th Percentile 3950.14
( 95th Percentile - 5th Percentile ) 411.12
Mean Distribution
Standard Deviation 3.5320
95.00% Confidence Interval ( 3732.76 - 3746.61 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 46
0.1% Error 4520
0.1 Scale Factor Error with Delta=300 141
0.05 Scale Factor Error with Delta=300 562
0.01 Scale Factor Error with Delta=300 14047
DPS(e)
Venthyr_Theotar Damage Per Second (Effective)
Count 1319
Mean 8682.74
Minimum 7925.26
Maximum 9400.24
Spread ( max - min ) 1474.98
Range [ ( max - min ) / 2 * 100% ] 8.49%
Damage
Venthyr_Theotar Damage
Count 1319
Mean 2597930.19
Minimum 1985950.21
Maximum 3154845.10
Spread ( max - min ) 1168894.89
Range [ ( max - min ) / 2 * 100% ] 22.50%
DTPS
Venthyr_Theotar Damage Taken Per Second
Count 1319
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Venthyr_Theotar Healing Per Second
Count 1319
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Venthyr_Theotar Healing Per Second (Effective)
Count 1319
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Venthyr_Theotar Heal
Count 1319
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Venthyr_Theotar Healing Taken Per Second
Count 1319
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Venthyr_Theotar Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Venthyr_TheotarTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Venthyr_Theotar Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 variable,name=prepull_evo,op=reset,default=0
1 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
2 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
3 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
4 0.00 variable,name=have_opened,op=reset,default=0
5 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
6 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
7 0.00 variable,name=final_burn,op=set,value=0
8 0.00 variable,name=rs_max_delay,op=reset,default=5
9 0.00 variable,name=ap_max_delay,op=reset,default=10
A 0.00 variable,name=rop_max_delay,op=reset,default=20
B 0.00 variable,name=totm_max_delay,op=reset,default=5
C 0.00 variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
D 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
E 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
F 0.00 variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
G 0.00 variable,name=barrage_mana_pct,op=reset,default=70
H 0.00 variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
I 0.00 variable,name=ap_minimum_mana_pct,op=reset,default=30
J 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
K 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
L 0.00 variable,name=totm_max_charges,op=reset,default=2
M 0.00 variable,name=aoe_totm_max_charges,op=reset,default=2
N 0.00 variable,name=am_spam,op=reset,default=0
O 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
P 0.00 variable,name=am_spam_evo_pct,op=reset,default=15
Q 0.00 flask
R 0.00 food
S 0.00 augmentation
T 0.00 arcane_familiar
U 0.00 arcane_intellect
V 0.00 conjure_mana_gem
W 0.00 snapshot_stats
X 0.00 mirror_image
Y 0.00 frostbolt,if=variable.prepull_evo<=0
Z 0.00 evocation,if=variable.prepull_evo>0
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
a 0.00 call_action_list,name=shared_cds
b 0.00 call_action_list,name=essences
c 0.00 call_action_list,name=aoe,if=active_enemies>2
d 0.00 call_action_list,name=opener,if=variable.have_opened<=0
e 0.00 call_action_list,name=am_spam,if=variable.am_spam=1
f 0.00 call_action_list,name=cooldowns
g 0.00 call_action_list,name=rotation,if=variable.final_burn=0
h 0.00 call_action_list,name=final_burn,if=variable.final_burn=1
i 0.00 call_action_list,name=movement
actions.aoe
# count action,conditions
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
0.00 arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
j 2.86 mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
k 6.16 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
l 2.84 arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
m 6.03 rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
0.00 presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
0.00 arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
0.00 supernova
n 13.31 arcane_orb,if=buff.arcane_charge.stack=0
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
o 165.39 arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
0.00 arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
p 60.15 arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
q 0.79 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.shared_cds
# count action,conditions
r 2.74 use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
s 2.84 use_items,if=buff.arcane_power.up
t 1.00 potion,if=buff.arcane_power.up
u 1.49 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
0.00 lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
v 1.84 berserking,if=buff.arcane_power.up
0.00 blood_fury,if=buff.arcane_power.up
0.00 fireblood,if=buff.arcane_power.up
0.00 ancestral_call,if=buff.arcane_power.up

Sample Sequence

045789ABGILMNPQRVXYjuklstvpnpoooopoooopoooompoooorpoooopnpoooopoooopoooopoooopoooopnpoooopoooopkmpoooopnpoooopoooopooqoopnpoooopokmpoooopnpoooolspoooopoooopnpoooorpoooopjkmpnpoooopoooopoooopnpoooopoooopoooopkmpnpoooopoooopoooopnpoooopoooopoooopjklsvpnpoooopooorompoooopnpoooopoooopooouopnpoooopoooopoooopkmpnpoooopoooopoooopoooopnpoo

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 prepull_evo Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat 4 have_opened Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat 5 have_opened Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat 7 final_burn Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat 8 rs_max_delay Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat 9 ap_max_delay Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat A rop_max_delay Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat B totm_max_delay Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat G barrage_mana_pct Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat I ap_minimum_mana_pct Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat L totm_max_charges Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat M aoe_totm_max_charges Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat N am_spam Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat P am_spam_evo_pct Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat Q flask Venthyr_Theotar 67365.7/67366: 100% mana
Pre precombat R food Venthyr_Theotar 67365.7/67366: 100% mana
Pre precombat V conjure_mana_gem Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat X mirror_image Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat Y frostbolt Fluffy_Pillow 67365.7/67366: 100% mana
0:00.000 aoe j mirrors_of_torment Fluffy_Pillow 66365.7/67366: 99% mana
0:01.299 shared_cds u time_warp Fluffy_Pillow 65371.1/67366: 97% mana bloodlust, crimson_chorus
0:01.299 aoe k touch_of_the_magi Fluffy_Pillow 63371.1/67366: 94% mana bloodlust, temporal_warp, crimson_chorus
0:02.070 aoe l arcane_power Fluffy_Pillow 61909.9/67366: 92% mana bloodlust, arcane_charge(4), clearcasting, temporal_warp, crimson_chorus
0:02.070 shared_cds s use_items Fluffy_Pillow 61909.9/67366: 92% mana bloodlust, arcane_charge(4), arcane_power, clearcasting, rune_of_power, temporal_warp, crimson_chorus
0:02.070 shared_cds t potion Fluffy_Pillow 61909.9/67366: 92% mana bloodlust, arcane_charge(4), arcane_power, clearcasting, rune_of_power, temporal_warp, crimson_chorus, gladiators_badge
0:02.070 shared_cds v berserking Fluffy_Pillow 61909.9/67366: 92% mana bloodlust, arcane_charge(4), arcane_power, clearcasting, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:02.070 aoe p arcane_barrage Fluffy_Pillow 61909.9/67366: 92% mana bloodlust, berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:02.825 aoe n arcane_orb Fluffy_Pillow 67365.7/67366: 100% mana bloodlust, berserking, arcane_power, clearcasting, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:03.580 aoe p arcane_barrage Fluffy_Pillow 67365.7/67366: 100% mana bloodlust, berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:04.335 aoe o arcane_explosion Fluffy_Pillow 67365.7/67366: 100% mana bloodlust, berserking, arcane_power, clearcasting, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:05.088 aoe o arcane_explosion Fluffy_Pillow 67365.7/67366: 100% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:05.840 aoe o arcane_explosion Fluffy_Pillow 65878.9/67366: 98% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:06.594 aoe o arcane_explosion Fluffy_Pillow 64394.8/67366: 96% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:07.348 aoe p arcane_barrage Fluffy_Pillow 62910.6/67366: 93% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:08.102 aoe o arcane_explosion Fluffy_Pillow 66621.1/67366: 99% mana bloodlust, berserking, arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:08.855 aoe o arcane_explosion Fluffy_Pillow 67365.7/67366: 100% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:09.610 aoe o arcane_explosion Fluffy_Pillow 65882.9/67366: 98% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:10.364 aoe o arcane_explosion Fluffy_Pillow 64398.8/67366: 96% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:11.120 aoe p arcane_barrage Fluffy_Pillow 62917.4/67366: 93% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:11.873 aoe o arcane_explosion Fluffy_Pillow 66626.5/67366: 99% mana bloodlust, berserking, arcane_power, rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:12.628 aoe o arcane_explosion Fluffy_Pillow 65143.8/67366: 97% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:13.384 aoe o arcane_explosion Fluffy_Pillow 63662.3/67366: 95% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:14.140 aoe o arcane_explosion Fluffy_Pillow 62180.9/67366: 92% mana bloodlust, arcane_charge(3), arcane_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:14.911 aoe m rune_of_power Fluffy_Pillow 63414.3/67366: 94% mana bloodlust, arcane_charge(4), arcane_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:15.682 aoe p arcane_barrage Fluffy_Pillow 64453.1/67366: 96% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:16.452 aoe o arcane_explosion Fluffy_Pillow 67365.7/67366: 100% mana bloodlust, arcane_power, rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:17.223 aoe o arcane_explosion Fluffy_Pillow 65904.5/67366: 98% mana bloodlust, arcane_charge, rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation
0:17.994 aoe o arcane_explosion Fluffy_Pillow 61943.3/67366: 92% mana bloodlust, arcane_charge(2), rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation
0:18.763 aoe o arcane_explosion Fluffy_Pillow 57979.4/67366: 86% mana bloodlust, arcane_charge(3), rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation
0:19.534 shared_cds r use_mana_gem Venthyr_Theotar 54018.1/67366: 80% mana bloodlust, arcane_charge(4), rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation
0:19.534 aoe p arcane_barrage Fluffy_Pillow 60754.7/67366: 90% mana bloodlust, arcane_charge(4), rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation
0:20.304 aoe o arcane_explosion Fluffy_Pillow 64486.8/67366: 96% mana bloodlust, rune_of_power, temporal_warp, crimson_chorus(3), potion_of_deathly_fixation
0:21.075 aoe o arcane_explosion Fluffy_Pillow 60525.5/67366: 90% mana bloodlust, arcane_charge, rune_of_power, temporal_warp, crimson_chorus(3), potion_of_deathly_fixation
0:21.845 aoe o arcane_explosion Fluffy_Pillow 56563.0/67366: 84% mana bloodlust, arcane_charge(2), rune_of_power, temporal_warp, crimson_chorus(3), potion_of_deathly_fixation
0:22.615 aoe o arcane_explosion Fluffy_Pillow 52600.4/67366: 78% mana bloodlust, arcane_charge(3), rune_of_power, temporal_warp, crimson_chorus(3), potion_of_deathly_fixation
0:23.385 aoe p arcane_barrage Fluffy_Pillow 48637.8/67366: 72% mana bloodlust, arcane_charge(4), rune_of_power, temporal_warp, crimson_chorus(3), potion_of_deathly_fixation
0:24.155 aoe n arcane_orb Fluffy_Pillow 52369.9/67366: 78% mana bloodlust, rune_of_power, temporal_warp, crimson_chorus(3), potion_of_deathly_fixation
0:24.925 aoe p arcane_barrage Fluffy_Pillow 52907.3/67366: 79% mana bloodlust, arcane_charge(4), rune_of_power, temporal_warp, crimson_chorus(3), potion_of_deathly_fixation
0:25.697 aoe o arcane_explosion Fluffy_Pillow 56642.1/67366: 84% mana bloodlust, rune_of_power, temporal_warp, crimson_chorus(3), potion_of_deathly_fixation
0:26.468 aoe o arcane_explosion Fluffy_Pillow 52680.9/67366: 78% mana bloodlust, arcane_charge, rune_of_power, temporal_warp, crimson_chorus(3), potion_of_deathly_fixation
0:27.238 aoe o arcane_explosion Fluffy_Pillow 48718.3/67366: 72% mana bloodlust, arcane_charge(2), rune_of_power, temporal_warp, crimson_chorus(3)
0:28.009 aoe o arcane_explosion Fluffy_Pillow 44757.1/67366: 66% mana bloodlust, arcane_charge(3), temporal_warp, crimson_chorus(3)
0:28.779 aoe p arcane_barrage Fluffy_Pillow 40794.5/67366: 61% mana bloodlust, arcane_charge(4), temporal_warp, crimson_chorus(3)
0:29.550 aoe o arcane_explosion Fluffy_Pillow 44527.9/67366: 66% mana bloodlust, temporal_warp, crimson_chorus(3)
0:30.321 aoe o arcane_explosion Fluffy_Pillow 40566.7/67366: 60% mana bloodlust, arcane_charge, temporal_warp
0:31.092 aoe o arcane_explosion Fluffy_Pillow 36605.5/67366: 54% mana bloodlust, arcane_charge(2), clearcasting, temporal_warp
0:31.863 aoe o arcane_explosion Fluffy_Pillow 37644.3/67366: 56% mana bloodlust, arcane_charge(3), temporal_warp
0:32.634 aoe p arcane_barrage Fluffy_Pillow 33683.0/67366: 50% mana bloodlust, arcane_charge(4), temporal_warp
0:33.405 aoe o arcane_explosion Fluffy_Pillow 37416.4/67366: 56% mana bloodlust, temporal_warp
0:34.175 aoe o arcane_explosion Fluffy_Pillow 33453.9/67366: 50% mana bloodlust, arcane_charge, temporal_warp
0:34.946 aoe o arcane_explosion Fluffy_Pillow 29492.7/67366: 44% mana bloodlust, arcane_charge(2), temporal_warp
0:35.716 aoe o arcane_explosion Fluffy_Pillow 25530.1/67366: 38% mana bloodlust, arcane_charge(3), temporal_warp
0:36.485 aoe p arcane_barrage Fluffy_Pillow 21566.2/67366: 32% mana bloodlust, arcane_charge(4), temporal_warp
0:37.256 aoe o arcane_explosion Fluffy_Pillow 25299.6/67366: 38% mana bloodlust, temporal_warp
0:38.027 aoe o arcane_explosion Fluffy_Pillow 21338.4/67366: 32% mana bloodlust, arcane_charge, clearcasting, temporal_warp
0:38.798 aoe o arcane_explosion Fluffy_Pillow 22377.1/67366: 33% mana bloodlust, arcane_charge(2), temporal_warp
0:39.569 aoe o arcane_explosion Fluffy_Pillow 18415.9/67366: 27% mana bloodlust, arcane_charge(3), clearcasting, temporal_warp
0:40.340 aoe p arcane_barrage Fluffy_Pillow 19454.7/67366: 29% mana bloodlust, arcane_charge(4), temporal_warp
0:41.111 aoe o arcane_explosion Fluffy_Pillow 23188.1/67366: 34% mana temporal_warp
0:42.111 aoe o arcane_explosion Fluffy_Pillow 19535.4/67366: 29% mana arcane_charge
0:43.409 aoe o arcane_explosion Fluffy_Pillow 16284.2/67366: 24% mana arcane_charge(2), clearcasting
0:44.706 aoe o arcane_explosion Fluffy_Pillow 18031.7/67366: 27% mana arcane_charge(3)
0:46.006 aoe p arcane_barrage Fluffy_Pillow 14783.2/67366: 22% mana arcane_charge(4)
0:47.306 aoe n arcane_orb Fluffy_Pillow 19229.3/67366: 29% mana
0:48.605 aoe p arcane_barrage Fluffy_Pillow 20479.5/67366: 30% mana arcane_charge(4)
0:49.903 aoe o arcane_explosion Fluffy_Pillow 24923.0/67366: 37% mana
0:51.205 aoe o arcane_explosion Fluffy_Pillow 21677.2/67366: 32% mana arcane_charge, clearcasting
0:52.504 aoe o arcane_explosion Fluffy_Pillow 23427.3/67366: 35% mana arcane_charge(2)
0:53.804 aoe o arcane_explosion Fluffy_Pillow 20178.8/67366: 30% mana arcane_charge(3)
0:55.104 aoe p arcane_barrage Fluffy_Pillow 16930.3/67366: 25% mana arcane_charge(4)
0:56.403 aoe o arcane_explosion Fluffy_Pillow 21375.1/67366: 32% mana
0:57.703 aoe o arcane_explosion Fluffy_Pillow 18126.6/67366: 27% mana arcane_charge
0:59.002 aoe o arcane_explosion Fluffy_Pillow 14876.8/67366: 22% mana arcane_charge(2)
1:00.301 aoe o arcane_explosion Fluffy_Pillow 11627.0/67366: 17% mana arcane_charge(3)
1:01.601 aoe p arcane_barrage Fluffy_Pillow 8378.5/67366: 12% mana arcane_charge(4), crimson_chorus
1:02.900 aoe k touch_of_the_magi Fluffy_Pillow 12823.3/67366: 19% mana crimson_chorus
1:04.200 aoe m rune_of_power Fluffy_Pillow 12074.8/67366: 18% mana arcane_charge(4), clearcasting, crimson_chorus
1:05.498 aoe p arcane_barrage Fluffy_Pillow 13823.6/67366: 21% mana arcane_charge(4), clearcasting, rune_of_power, crimson_chorus
1:06.796 aoe o arcane_explosion Fluffy_Pillow 18267.0/67366: 27% mana clearcasting, rune_of_power, crimson_chorus
1:08.094 aoe o arcane_explosion Fluffy_Pillow 20015.8/67366: 30% mana arcane_charge, rune_of_power, crimson_chorus
1:09.395 aoe o arcane_explosion Fluffy_Pillow 16768.7/67366: 25% mana arcane_charge(2), rune_of_power, crimson_chorus
1:10.694 aoe o arcane_explosion Fluffy_Pillow 13518.8/67366: 20% mana arcane_charge(3), rune_of_power, crimson_chorus(2)
1:11.993 aoe p arcane_barrage Fluffy_Pillow 10269.0/67366: 15% mana arcane_charge(4), rune_of_power, crimson_chorus(2)
1:13.293 aoe n arcane_orb Fluffy_Pillow 14715.1/67366: 22% mana rune_of_power, crimson_chorus(2)
1:14.591 aoe p arcane_barrage Fluffy_Pillow 15964.0/67366: 24% mana arcane_charge(4), rune_of_power, crimson_chorus(2)
1:15.890 aoe o arcane_explosion Fluffy_Pillow 20408.8/67366: 30% mana rune_of_power, crimson_chorus(2)
1:17.191 aoe o arcane_explosion Fluffy_Pillow 17161.6/67366: 25% mana arcane_charge, rune_of_power, crimson_chorus(2)
1:18.491 aoe o arcane_explosion Fluffy_Pillow 13913.1/67366: 21% mana arcane_charge(2), crimson_chorus(2)
1:19.790 aoe o arcane_explosion Fluffy_Pillow 10663.3/67366: 16% mana arcane_charge(3), crimson_chorus(2)
1:21.088 aoe p arcane_barrage Fluffy_Pillow 7412.1/67366: 11% mana arcane_charge(4), clearcasting, crimson_chorus(3)
1:22.386 aoe o arcane_explosion Fluffy_Pillow 11855.5/67366: 18% mana clearcasting, crimson_chorus(3)
1:23.686 aoe o arcane_explosion Fluffy_Pillow 13607.0/67366: 20% mana arcane_charge, crimson_chorus(3)
1:24.983 aoe o arcane_explosion Fluffy_Pillow 10354.5/67366: 15% mana arcane_charge(2), crimson_chorus(3)
1:26.283 aoe o arcane_explosion Fluffy_Pillow 7106.0/67366: 11% mana arcane_charge(3), crimson_chorus(3)
1:27.582 aoe p arcane_barrage Fluffy_Pillow 3856.2/67366: 6% mana arcane_charge(4), crimson_chorus(3)
1:28.883 aoe o arcane_explosion Fluffy_Pillow 8303.7/67366: 12% mana crimson_chorus(3)
1:30.182 aoe o arcane_explosion Fluffy_Pillow 5053.8/67366: 8% mana arcane_charge, crimson_chorus(3)
1:31.481 aoe q evocation Venthyr_Theotar 1804.0/67366: 3% mana arcane_charge(2)
1:35.799 aoe o arcane_explosion Fluffy_Pillow 59010.9/67366: 88% mana arcane_charge(2)
1:37.100 aoe o arcane_explosion Fluffy_Pillow 55763.8/67366: 83% mana arcane_charge(3)
1:38.400 aoe p arcane_barrage Fluffy_Pillow 52515.3/67366: 78% mana arcane_charge(4), clearcasting
1:39.699 aoe n arcane_orb Fluffy_Pillow 56960.1/67366: 85% mana clearcasting
1:40.998 aoe p arcane_barrage Fluffy_Pillow 58210.2/67366: 86% mana arcane_charge(4), clearcasting
1:42.297 aoe o arcane_explosion Fluffy_Pillow 62655.0/67366: 93% mana clearcasting
1:43.596 aoe o arcane_explosion Fluffy_Pillow 64405.2/67366: 96% mana arcane_charge
1:44.894 aoe o arcane_explosion Fluffy_Pillow 61154.0/67366: 91% mana arcane_charge(2)
1:46.193 aoe o arcane_explosion Fluffy_Pillow 57904.2/67366: 86% mana arcane_charge(3), clearcasting
1:47.493 aoe p arcane_barrage Fluffy_Pillow 59655.7/67366: 89% mana arcane_charge(4)
1:48.792 aoe o arcane_explosion Fluffy_Pillow 72324.9/76009: 95% mana soothing_shade
1:50.092 aoe k touch_of_the_magi Fluffy_Pillow 69301.2/76009: 91% mana arcane_charge, soothing_shade
1:51.392 aoe m rune_of_power Fluffy_Pillow 68777.4/76009: 90% mana arcane_charge(4), clearcasting, soothing_shade
1:52.690 aoe p arcane_barrage Fluffy_Pillow 70750.6/76009: 93% mana arcane_charge(4), clearcasting, rune_of_power, soothing_shade
1:53.987 aoe o arcane_explosion Fluffy_Pillow 75762.7/76009: 100% mana clearcasting, rune_of_power, soothing_shade
1:55.288 aoe o arcane_explosion Fluffy_Pillow 76009.1/76009: 100% mana arcane_charge, rune_of_power, soothing_shade
1:56.588 aoe o arcane_explosion Fluffy_Pillow 72985.4/76009: 96% mana arcane_charge(2), rune_of_power, soothing_shade
1:57.889 aoe o arcane_explosion Fluffy_Pillow 69963.1/76009: 92% mana arcane_charge(3), rune_of_power, soothing_shade
1:59.190 aoe p arcane_barrage Fluffy_Pillow 66940.9/76009: 88% mana arcane_charge(4), clearcasting, rune_of_power, soothing_shade
2:00.491 aoe n arcane_orb Fluffy_Pillow 63776.2/67366: 95% mana clearcasting, rune_of_power
2:01.790 aoe p arcane_barrage Fluffy_Pillow 65026.3/67366: 97% mana arcane_charge(4), clearcasting, rune_of_power, crimson_chorus
2:03.090 aoe o arcane_explosion Fluffy_Pillow 67365.7/67366: 100% mana clearcasting, rune_of_power, crimson_chorus
2:04.390 aoe o arcane_explosion Fluffy_Pillow 67365.7/67366: 100% mana arcane_charge, rune_of_power, crimson_chorus
2:05.690 aoe o arcane_explosion Fluffy_Pillow 64117.2/67366: 95% mana arcane_charge(2), clearcasting, crimson_chorus
2:06.988 aoe o arcane_explosion Fluffy_Pillow 65866.0/67366: 98% mana arcane_charge(3), crimson_chorus
2:08.288 aoe l arcane_power Fluffy_Pillow 62617.5/67366: 93% mana arcane_charge(4), clearcasting, crimson_chorus
2:08.288 shared_cds s use_items Fluffy_Pillow 62617.5/67366: 93% mana arcane_charge(4), arcane_power, clearcasting, rune_of_power, crimson_chorus
2:08.288 aoe p arcane_barrage Fluffy_Pillow 62617.5/67366: 93% mana arcane_charge(4), arcane_power, clearcasting, rune_of_power, crimson_chorus, gladiators_badge
2:09.587 aoe o arcane_explosion Fluffy_Pillow 75666.8/76009: 100% mana arcane_power, clearcasting, rune_of_power, crimson_chorus, soothing_shade, gladiators_badge
2:10.886 aoe o arcane_explosion Fluffy_Pillow 76009.1/76009: 100% mana arcane_charge, arcane_power, rune_of_power, crimson_chorus, soothing_shade, gladiators_badge
2:12.188 aoe o arcane_explosion Fluffy_Pillow 75488.4/76009: 99% mana arcane_charge(2), arcane_power, rune_of_power, crimson_chorus(2), soothing_shade, gladiators_badge
2:13.486 aoe o arcane_explosion Fluffy_Pillow 74961.6/76009: 99% mana arcane_charge(3), arcane_power, rune_of_power, crimson_chorus(2), soothing_shade, gladiators_badge
2:14.785 aoe p arcane_barrage Fluffy_Pillow 74436.3/76009: 98% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), soothing_shade, gladiators_badge
2:16.085 aoe o arcane_explosion Fluffy_Pillow 76009.1/76009: 100% mana arcane_power, rune_of_power, crimson_chorus(2), soothing_shade, gladiators_badge
2:17.382 aoe o arcane_explosion Fluffy_Pillow 75480.8/76009: 99% mana arcane_charge, arcane_power, rune_of_power, crimson_chorus(2), soothing_shade, gladiators_badge
2:18.681 aoe o arcane_explosion Fluffy_Pillow 74955.5/76009: 99% mana arcane_charge(2), arcane_power, rune_of_power, crimson_chorus(2), soothing_shade, gladiators_badge
2:19.980 aoe o arcane_explosion Fluffy_Pillow 74430.3/76009: 98% mana arcane_charge(3), arcane_power, rune_of_power, crimson_chorus(2), soothing_shade, gladiators_badge
2:21.279 aoe p arcane_barrage Fluffy_Pillow 65500.8/67366: 97% mana arcane_charge(4), arcane_power, crimson_chorus(3), gladiators_badge
2:22.577 aoe n arcane_orb Fluffy_Pillow 67365.7/67366: 100% mana arcane_power, crimson_chorus(3), gladiators_badge
2:23.878 aoe p arcane_barrage Fluffy_Pillow 67365.7/67366: 100% mana arcane_charge(4), crimson_chorus(3)
2:25.178 aoe o arcane_explosion Fluffy_Pillow 67365.7/67366: 100% mana crimson_chorus(3)
2:26.477 aoe o arcane_explosion Fluffy_Pillow 64115.9/67366: 95% mana arcane_charge, crimson_chorus(3)
2:27.776 aoe o arcane_explosion Fluffy_Pillow 60866.0/67366: 90% mana arcane_charge(2), crimson_chorus(3)
2:29.075 aoe o arcane_explosion Fluffy_Pillow 57616.2/67366: 86% mana arcane_charge(3), crimson_chorus(3)
2:30.375 shared_cds r use_mana_gem Venthyr_Theotar 54367.7/67366: 81% mana arcane_charge(4), crimson_chorus(3)
2:30.375 aoe p arcane_barrage Fluffy_Pillow 61104.3/67366: 91% mana arcane_charge(4), crimson_chorus(3)
2:31.675 aoe o arcane_explosion Fluffy_Pillow 65550.4/67366: 97% mana
2:32.975 aoe o arcane_explosion Fluffy_Pillow 62301.9/67366: 92% mana arcane_charge
2:34.274 aoe o arcane_explosion Fluffy_Pillow 59052.1/67366: 88% mana arcane_charge(2)
2:35.575 aoe o arcane_explosion Fluffy_Pillow 55804.9/67366: 83% mana arcane_charge(3)
2:36.875 aoe p arcane_barrage Fluffy_Pillow 52556.4/67366: 78% mana arcane_charge(4), clearcasting
2:38.175 aoe j mirrors_of_torment Fluffy_Pillow 57002.6/67366: 85% mana clearcasting
2:39.474 aoe k touch_of_the_magi Fluffy_Pillow 56752.7/67366: 84% mana clearcasting
2:40.776 aoe m rune_of_power Fluffy_Pillow 56007.0/67366: 83% mana arcane_charge(4), clearcasting
2:42.075 aoe p arcane_barrage Fluffy_Pillow 60451.7/67366: 90% mana arcane_charge(4), clearcasting, rune_of_power
2:43.375 aoe n arcane_orb Fluffy_Pillow 64897.9/67366: 96% mana clearcasting, rune_of_power
2:44.675 aoe p arcane_barrage Fluffy_Pillow 66149.4/67366: 98% mana arcane_charge(4), clearcasting, rune_of_power
2:45.972 aoe o arcane_explosion Fluffy_Pillow 67365.7/67366: 100% mana clearcasting, rune_of_power
2:47.272 aoe o arcane_explosion Fluffy_Pillow 67365.7/67366: 100% mana arcane_charge, rune_of_power
2:48.571 aoe o arcane_explosion Fluffy_Pillow 64115.9/67366: 95% mana arcane_charge(2), rune_of_power
2:49.870 aoe o arcane_explosion Fluffy_Pillow 60866.0/67366: 90% mana arcane_charge(3), rune_of_power
2:51.168 aoe p arcane_barrage Fluffy_Pillow 57614.9/67366: 86% mana arcane_charge(4), rune_of_power
2:52.468 aoe o arcane_explosion Fluffy_Pillow 62061.0/67366: 92% mana rune_of_power
2:53.768 aoe o arcane_explosion Fluffy_Pillow 61507.1/67366: 91% mana arcane_charge, rune_of_power
2:55.067 aoe o arcane_explosion Fluffy_Pillow 58257.3/67366: 86% mana arcane_charge(2)
2:56.368 aoe o arcane_explosion Fluffy_Pillow 55010.1/67366: 82% mana arcane_charge(3)
2:57.669 aoe p arcane_barrage Fluffy_Pillow 51763.0/67366: 77% mana arcane_charge(4)
2:58.968 aoe o arcane_explosion Fluffy_Pillow 56207.8/67366: 83% mana
3:00.267 aoe o arcane_explosion Fluffy_Pillow 52957.9/67366: 79% mana arcane_charge
3:01.566 aoe o arcane_explosion Fluffy_Pillow 49708.1/67366: 74% mana arcane_charge(2)
3:02.866 aoe o arcane_explosion Fluffy_Pillow 46459.6/67366: 69% mana arcane_charge(3), clearcasting, crimson_chorus
3:04.165 aoe p arcane_barrage Fluffy_Pillow 48209.8/67366: 72% mana arcane_charge(4), crimson_chorus
3:05.464 aoe n arcane_orb Fluffy_Pillow 52654.6/67366: 78% mana crimson_chorus
3:06.765 aoe p arcane_barrage Fluffy_Pillow 53907.4/67366: 80% mana arcane_charge(4), crimson_chorus
3:08.063 aoe o arcane_explosion Fluffy_Pillow 58350.9/67366: 87% mana crimson_chorus
3:09.364 aoe o arcane_explosion Fluffy_Pillow 55103.7/67366: 82% mana arcane_charge, crimson_chorus
3:10.663 aoe o arcane_explosion Fluffy_Pillow 51853.9/67366: 77% mana arcane_charge(2), crimson_chorus
3:11.963 aoe o arcane_explosion Fluffy_Pillow 48605.4/67366: 72% mana arcane_charge(3), clearcasting, crimson_chorus(2)
3:13.261 aoe p arcane_barrage Fluffy_Pillow 50354.2/67366: 75% mana arcane_charge(4), crimson_chorus(2)
3:14.561 aoe o arcane_explosion Fluffy_Pillow 54800.3/67366: 81% mana crimson_chorus(2)
3:15.862 aoe o arcane_explosion Fluffy_Pillow 51553.2/67366: 77% mana arcane_charge, crimson_chorus(2)
3:17.160 aoe o arcane_explosion Fluffy_Pillow 48302.0/67366: 72% mana arcane_charge(2), crimson_chorus(2)
3:18.460 aoe o arcane_explosion Fluffy_Pillow 45053.5/67366: 67% mana arcane_charge(3), crimson_chorus(2)
3:19.759 aoe p arcane_barrage Fluffy_Pillow 47167.4/76009: 62% mana arcane_charge(4), crimson_chorus(2), soothing_shade
3:21.057 aoe o arcane_explosion Fluffy_Pillow 52180.9/76009: 69% mana crimson_chorus(2), soothing_shade
3:22.356 aoe o arcane_explosion Fluffy_Pillow 49155.6/76009: 65% mana arcane_charge, crimson_chorus(3), soothing_shade
3:23.657 aoe o arcane_explosion Fluffy_Pillow 46133.4/76009: 61% mana arcane_charge(2), crimson_chorus(3), soothing_shade
3:24.956 aoe o arcane_explosion Fluffy_Pillow 43108.1/76009: 57% mana arcane_charge(3), crimson_chorus(3), soothing_shade
3:26.256 aoe p arcane_barrage Fluffy_Pillow 40084.3/76009: 53% mana arcane_charge(4), crimson_chorus(3), soothing_shade
3:27.555 aoe k touch_of_the_magi Fluffy_Pillow 45099.4/76009: 59% mana crimson_chorus(3), soothing_shade
3:28.854 aoe m rune_of_power Fluffy_Pillow 44574.1/76009: 59% mana arcane_charge(4), crimson_chorus(3), soothing_shade
3:30.152 aoe p arcane_barrage Fluffy_Pillow 46547.3/76009: 61% mana arcane_charge(4), rune_of_power, crimson_chorus(3), soothing_shade
3:31.452 aoe n arcane_orb Fluffy_Pillow 45700.3/67366: 68% mana rune_of_power, crimson_chorus(3)
3:32.752 aoe p arcane_barrage Fluffy_Pillow 46951.8/67366: 70% mana arcane_charge(4), rune_of_power
3:34.050 aoe o arcane_explosion Fluffy_Pillow 51395.3/67366: 76% mana rune_of_power
3:35.350 aoe o arcane_explosion Fluffy_Pillow 48146.8/67366: 71% mana arcane_charge, rune_of_power
3:36.648 aoe o arcane_explosion Fluffy_Pillow 44895.6/67366: 67% mana arcane_charge(2), rune_of_power
3:37.947 aoe o arcane_explosion Fluffy_Pillow 41645.8/67366: 62% mana arcane_charge(3), rune_of_power
3:39.247 aoe p arcane_barrage Fluffy_Pillow 38397.3/67366: 57% mana arcane_charge(4), rune_of_power
3:40.546 aoe o arcane_explosion Fluffy_Pillow 42842.1/67366: 64% mana rune_of_power
3:41.845 aoe o arcane_explosion Fluffy_Pillow 39592.2/67366: 59% mana arcane_charge, rune_of_power
3:43.145 aoe o arcane_explosion Fluffy_Pillow 36343.7/67366: 54% mana arcane_charge(2)
3:44.445 aoe o arcane_explosion Fluffy_Pillow 33095.2/67366: 49% mana arcane_charge(3)
3:45.745 aoe p arcane_barrage Fluffy_Pillow 29846.7/67366: 44% mana arcane_charge(4)
3:47.045 aoe o arcane_explosion Fluffy_Pillow 34292.9/67366: 51% mana
3:48.345 aoe o arcane_explosion Fluffy_Pillow 31044.4/67366: 46% mana arcane_charge, clearcasting
3:49.645 aoe o arcane_explosion Fluffy_Pillow 32795.9/67366: 49% mana arcane_charge(2)
3:50.944 aoe o arcane_explosion Fluffy_Pillow 29546.1/67366: 44% mana arcane_charge(3)
3:52.243 aoe p arcane_barrage Fluffy_Pillow 26296.2/67366: 39% mana arcane_charge(4)
3:53.544 aoe n arcane_orb Fluffy_Pillow 30743.7/67366: 46% mana
3:54.843 aoe p arcane_barrage Fluffy_Pillow 31993.9/67366: 47% mana arcane_charge(4)
3:56.142 aoe o arcane_explosion Fluffy_Pillow 36438.7/67366: 54% mana
3:57.442 aoe o arcane_explosion Fluffy_Pillow 33190.2/67366: 49% mana arcane_charge
3:58.741 aoe o arcane_explosion Fluffy_Pillow 29940.3/67366: 44% mana arcane_charge(2)
4:00.040 aoe o arcane_explosion Fluffy_Pillow 26690.5/67366: 40% mana arcane_charge(3)
4:01.340 aoe p arcane_barrage Fluffy_Pillow 23442.0/67366: 35% mana arcane_charge(4), clearcasting
4:02.638 aoe o arcane_explosion Fluffy_Pillow 27885.4/67366: 41% mana clearcasting, crimson_chorus
4:03.939 aoe o arcane_explosion Fluffy_Pillow 29638.3/67366: 44% mana arcane_charge, crimson_chorus
4:05.239 aoe o arcane_explosion Fluffy_Pillow 26389.8/67366: 39% mana arcane_charge(2), crimson_chorus
4:06.536 aoe o arcane_explosion Fluffy_Pillow 23137.3/67366: 34% mana arcane_charge(3), crimson_chorus
4:07.835 aoe p arcane_barrage Fluffy_Pillow 19887.4/67366: 30% mana arcane_charge(4), clearcasting, crimson_chorus
4:09.134 aoe o arcane_explosion Fluffy_Pillow 24332.2/67366: 36% mana clearcasting, crimson_chorus
4:10.433 aoe o arcane_explosion Fluffy_Pillow 26082.4/67366: 39% mana arcane_charge, crimson_chorus
4:11.733 aoe o arcane_explosion Fluffy_Pillow 22833.9/67366: 34% mana arcane_charge(2), crimson_chorus
4:13.033 aoe o arcane_explosion Fluffy_Pillow 19585.4/67366: 29% mana arcane_charge(3), clearcasting, crimson_chorus(2)
4:14.334 aoe p arcane_barrage Fluffy_Pillow 21338.2/67366: 32% mana arcane_charge(4), crimson_chorus(2)
4:15.634 aoe j mirrors_of_torment Fluffy_Pillow 25784.4/67366: 38% mana crimson_chorus(2)
4:16.933 aoe k touch_of_the_magi Fluffy_Pillow 25534.5/67366: 38% mana crimson_chorus(2)
4:18.231 aoe l arcane_power Fluffy_Pillow 24783.4/67366: 37% mana arcane_charge(4), crimson_chorus(2)
4:18.231 shared_cds s use_items Fluffy_Pillow 24783.4/67366: 37% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2)
4:18.231 shared_cds v berserking Fluffy_Pillow 24783.4/67366: 37% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:18.231 aoe p arcane_barrage Fluffy_Pillow 24783.4/67366: 37% mana berserking, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:19.415 aoe n arcane_orb Fluffy_Pillow 31767.8/67366: 47% mana berserking, arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:20.600 aoe p arcane_barrage Fluffy_Pillow 33114.4/67366: 49% mana berserking, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:21.783 aoe o arcane_explosion Fluffy_Pillow 37402.9/67366: 56% mana berserking, arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
4:22.968 aoe o arcane_explosion Fluffy_Pillow 36499.5/67366: 54% mana berserking, arcane_charge, arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
4:24.150 aoe o arcane_explosion Fluffy_Pillow 35592.0/67366: 53% mana berserking, arcane_charge(2), arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
4:25.332 aoe o arcane_explosion Fluffy_Pillow 37379.2/67366: 55% mana berserking, arcane_charge(3), arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
4:26.513 aoe p arcane_barrage Fluffy_Pillow 36470.3/67366: 54% mana berserking, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
4:27.697 aoe o arcane_explosion Fluffy_Pillow 40760.2/67366: 61% mana berserking, arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
4:28.880 aoe o arcane_explosion Fluffy_Pillow 39854.1/67366: 59% mana berserking, arcane_charge, arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
4:30.062 aoe o arcane_explosion Fluffy_Pillow 38946.6/67366: 58% mana berserking, arcane_charge(2), arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
4:31.246 shared_cds r use_mana_gem Venthyr_Theotar 40736.4/67366: 60% mana arcane_charge(3), arcane_power, crimson_chorus(3), gladiators_badge
4:31.246 aoe o arcane_explosion Fluffy_Pillow 47473.0/67366: 70% mana arcane_charge(3), arcane_power, crimson_chorus(3), gladiators_badge
4:32.545 aoe m rune_of_power Fluffy_Pillow 46723.2/67366: 69% mana arcane_charge(4), arcane_power, gladiators_badge
4:33.845 aoe p arcane_barrage Fluffy_Pillow 48474.7/67366: 72% mana arcane_charge(4), rune_of_power
4:35.144 aoe o arcane_explosion Fluffy_Pillow 52919.5/67366: 79% mana rune_of_power
4:36.443 aoe o arcane_explosion Fluffy_Pillow 49669.6/67366: 74% mana arcane_charge, clearcasting, rune_of_power
4:37.740 aoe o arcane_explosion Fluffy_Pillow 51417.1/67366: 76% mana arcane_charge(2), rune_of_power
4:39.040 aoe o arcane_explosion Fluffy_Pillow 48168.6/67366: 72% mana arcane_charge(3), clearcasting, rune_of_power
4:40.339 aoe p arcane_barrage Fluffy_Pillow 49918.8/67366: 74% mana arcane_charge(4), rune_of_power
4:41.638 aoe n arcane_orb Fluffy_Pillow 54363.5/67366: 81% mana rune_of_power
4:42.939 aoe p arcane_barrage Fluffy_Pillow 55616.4/67366: 83% mana arcane_charge(4), rune_of_power
4:44.241 aoe o arcane_explosion Fluffy_Pillow 60065.2/67366: 89% mana rune_of_power
4:45.540 aoe o arcane_explosion Fluffy_Pillow 56815.4/67366: 84% mana arcane_charge, clearcasting, rune_of_power
4:46.838 aoe o arcane_explosion Fluffy_Pillow 58564.2/67366: 87% mana arcane_charge(2)
4:48.138 aoe o arcane_explosion Fluffy_Pillow 55315.7/67366: 82% mana arcane_charge(3)
4:49.437 aoe p arcane_barrage Fluffy_Pillow 52065.9/67366: 77% mana arcane_charge(4)
4:50.735 aoe o arcane_explosion Fluffy_Pillow 56509.3/67366: 84% mana
4:52.034 aoe o arcane_explosion Fluffy_Pillow 53259.5/67366: 79% mana arcane_charge, clearcasting
4:53.334 aoe o arcane_explosion Fluffy_Pillow 55011.0/67366: 82% mana arcane_charge(2)
4:54.633 aoe o arcane_explosion Fluffy_Pillow 51761.2/67366: 77% mana arcane_charge(3)
4:55.932 aoe p arcane_barrage Fluffy_Pillow 48511.3/67366: 72% mana arcane_charge(4)
4:57.231 aoe o arcane_explosion Fluffy_Pillow 52956.1/67366: 79% mana
4:58.531 aoe o arcane_explosion Fluffy_Pillow 49707.6/67366: 74% mana arcane_charge, clearcasting
4:59.831 aoe o arcane_explosion Fluffy_Pillow 51459.1/67366: 76% mana arcane_charge(2)
5:01.132 shared_cds u time_warp Fluffy_Pillow 48212.0/67366: 72% mana arcane_charge(3)
5:01.299 aoe o arcane_explosion Fluffy_Pillow 46437.0/67366: 69% mana arcane_charge(3), temporal_warp
5:02.299 aoe p arcane_barrage Fluffy_Pillow 42784.3/67366: 64% mana arcane_charge(4), temporal_warp
5:03.301 aoe n arcane_orb Fluffy_Pillow 46828.9/67366: 70% mana temporal_warp, crimson_chorus
5:04.301 aoe p arcane_barrage Fluffy_Pillow 47676.2/67366: 71% mana arcane_charge(4), temporal_warp, crimson_chorus
5:05.301 aoe o arcane_explosion Fluffy_Pillow 51718.2/67366: 77% mana temporal_warp, crimson_chorus
5:06.301 aoe o arcane_explosion Fluffy_Pillow 48065.5/67366: 71% mana arcane_charge, temporal_warp, crimson_chorus
5:07.301 aoe o arcane_explosion Fluffy_Pillow 44412.8/67366: 66% mana arcane_charge(2), temporal_warp, crimson_chorus
5:08.301 aoe o arcane_explosion Fluffy_Pillow 40760.1/67366: 61% mana arcane_charge(3), temporal_warp, crimson_chorus
5:09.301 aoe p arcane_barrage Fluffy_Pillow 37107.4/67366: 55% mana arcane_charge(4), temporal_warp, crimson_chorus
5:10.303 aoe o arcane_explosion Fluffy_Pillow 41152.1/67366: 61% mana temporal_warp, crimson_chorus
5:11.304 aoe o arcane_explosion Fluffy_Pillow 37500.7/67366: 56% mana arcane_charge, temporal_warp, crimson_chorus
5:12.305 aoe o arcane_explosion Fluffy_Pillow 33849.4/67366: 50% mana arcane_charge(2), temporal_warp, crimson_chorus
5:13.307 aoe o arcane_explosion Fluffy_Pillow 30199.4/67366: 45% mana arcane_charge(3), temporal_warp, crimson_chorus(2)
5:14.308 aoe p arcane_barrage Fluffy_Pillow 26548.1/67366: 39% mana arcane_charge(4), temporal_warp, crimson_chorus(2)
5:15.311 aoe o arcane_explosion Fluffy_Pillow 30594.1/67366: 45% mana temporal_warp, crimson_chorus(2)
5:16.310 aoe o arcane_explosion Fluffy_Pillow 26940.0/67366: 40% mana arcane_charge, temporal_warp, crimson_chorus(2)
5:17.311 aoe o arcane_explosion Fluffy_Pillow 23288.7/67366: 35% mana arcane_charge(2), temporal_warp, crimson_chorus(2)
5:18.312 aoe o arcane_explosion Fluffy_Pillow 19637.4/67366: 29% mana arcane_charge(3), temporal_warp, crimson_chorus(2)
5:19.313 aoe p arcane_barrage Fluffy_Pillow 15986.0/67366: 24% mana arcane_charge(4), temporal_warp, crimson_chorus(2)
5:20.314 aoe k touch_of_the_magi Fluffy_Pillow 20029.3/67366: 30% mana temporal_warp, crimson_chorus(2)
5:21.314 aoe m rune_of_power Fluffy_Pillow 18876.6/67366: 28% mana arcane_charge(4), temporal_warp, crimson_chorus(2)
5:22.316 aoe p arcane_barrage Fluffy_Pillow 20226.6/67366: 30% mana arcane_charge(4), rune_of_power, temporal_warp, crimson_chorus(2)
5:23.318 aoe n arcane_orb Fluffy_Pillow 24271.3/67366: 36% mana rune_of_power, temporal_warp, crimson_chorus(3)
5:24.318 aoe p arcane_barrage Fluffy_Pillow 25118.6/67366: 37% mana arcane_charge(4), rune_of_power, temporal_warp, crimson_chorus(3)
5:25.319 aoe o arcane_explosion Fluffy_Pillow 29161.9/67366: 43% mana rune_of_power, temporal_warp, crimson_chorus(3)
5:26.319 aoe o arcane_explosion Fluffy_Pillow 25509.2/67366: 38% mana arcane_charge, rune_of_power, temporal_warp, crimson_chorus(3)
5:27.321 aoe o arcane_explosion Fluffy_Pillow 21859.2/67366: 32% mana arcane_charge(2), clearcasting, rune_of_power, temporal_warp, crimson_chorus(3)
5:28.322 aoe o arcane_explosion Fluffy_Pillow 23207.9/67366: 34% mana arcane_charge(3), rune_of_power, temporal_warp, crimson_chorus(3)
5:29.323 aoe p arcane_barrage Fluffy_Pillow 19556.5/67366: 29% mana arcane_charge(4), rune_of_power, temporal_warp, crimson_chorus(3)
5:30.323 aoe o arcane_explosion Fluffy_Pillow 23598.5/67366: 35% mana rune_of_power, temporal_warp, crimson_chorus(3)
5:31.321 aoe o arcane_explosion Fluffy_Pillow 19943.1/67366: 30% mana arcane_charge, rune_of_power, temporal_warp, crimson_chorus(3)
5:32.320 aoe o arcane_explosion Fluffy_Pillow 16289.0/67366: 24% mana arcane_charge(2), rune_of_power, temporal_warp, crimson_chorus(3)
5:33.319 aoe o arcane_explosion Fluffy_Pillow 14256.2/76009: 19% mana arcane_charge(3), rune_of_power, temporal_warp, soothing_shade
5:34.320 aoe p arcane_barrage Fluffy_Pillow 10777.9/76009: 14% mana arcane_charge(4), clearcasting, temporal_warp, soothing_shade
5:35.321 aoe o arcane_explosion Fluffy_Pillow 15339.9/76009: 20% mana clearcasting, temporal_warp, soothing_shade
5:36.320 aoe o arcane_explosion Fluffy_Pillow 16858.6/76009: 22% mana arcane_charge, temporal_warp, soothing_shade
5:37.319 aoe o arcane_explosion Fluffy_Pillow 13377.3/76009: 18% mana arcane_charge(2), temporal_warp, soothing_shade
5:38.319 aoe o arcane_explosion Fluffy_Pillow 9897.4/76009: 13% mana arcane_charge(3), temporal_warp, soothing_shade
5:39.319 aoe p arcane_barrage Fluffy_Pillow 6417.6/76009: 8% mana arcane_charge(4), temporal_warp, soothing_shade
5:40.320 aoe o arcane_explosion Fluffy_Pillow 10979.7/76009: 14% mana temporal_warp, soothing_shade
5:41.321 aoe o arcane_explosion Fluffy_Pillow 7501.4/76009: 10% mana arcane_charge, soothing_shade
5:42.620 aoe o arcane_explosion Fluffy_Pillow 4476.1/76009: 6% mana arcane_charge(2), clearcasting, soothing_shade
5:43.920 aoe o arcane_explosion Fluffy_Pillow 6452.3/76009: 8% mana arcane_charge(3), soothing_shade
5:45.221 aoe p arcane_barrage Fluffy_Pillow 3040.1/67366: 5% mana arcane_charge(4)
5:46.522 aoe n arcane_orb Fluffy_Pillow 7487.5/67366: 11% mana
5:47.825 aoe p arcane_barrage Fluffy_Pillow 8743.1/67366: 13% mana arcane_charge(4)
5:49.124 aoe o arcane_explosion Fluffy_Pillow 13187.9/67366: 20% mana
5:50.423 aoe o arcane_explosion Fluffy_Pillow 9938.0/67366: 15% mana arcane_charge

Stats

Level Bonus (60) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 198 1 199 199 0
Agility 306 2 308 308 0
Stamina 414 0 2013 1918 1504
Intellect 450 -3 1767 1588 1066 (46)
Spirit 0 0 0 0 0
Health 40260 38360 0
Mana 67366 67366 0
Spell Power 1767 1588 0
Crit 15.74% 15.74% 376
Haste 15.76% 15.76% 520
Versatility 7.97% 7.97% 319
Mana Regen 1347 1347 0
Mastery 34.73% 34.73% 733
Armor 369 369 369
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 227.00
Local Head Confidant's Favored Cap
ilevel: 226, stats: { 44 Armor, +82 Int, +149 Sta, +44 Haste, +98 Mastery }
Local Neck Noble's Birthstone Pendant
ilevel: 226, stats: { +84 Sta, +52 Crit, +162 Mastery }
Local Shoulders Shawl of the Penitent
ilevel: 233, stats: { 42 Armor, +65 Int, +122 Sta, +33 Crit, +76 Haste }
Local Chest Robes of the Cursed Commando
ilevel: 233, stats: { 61 Armor, +87 Int, +162 Sta, +47 Crit, +100 Haste }, enchant: { +20 Int }
Local Waist Cinch of Infinite Tightness
ilevel: 226, stats: { 33 Armor, +61 Int, +112 Sta, +69 Crit, +36 Vers }
Local Legs Courtier's Costume Trousers
ilevel: 226, stats: { 51 Armor, +82 Int, +149 Sta, +49 Vers, +93 Mastery }
Local Feet Slippers of the Forgotten Heretic
ilevel: 226, stats: { 36 Armor, +61 Int, +112 Sta, +73 Crit, +32 Mastery }
Local Wrists Acolyte's Velvet Bindings
ilevel: 226, stats: { 29 Armor, +46 Int, +84 Sta, +26 Vers, +53 Mastery }, enchant: { +15 Int }
Local Hands Impossibly Oversized Mitts
ilevel: 226, stats: { 33 Armor, +61 Int, +112 Sta, +31 Haste, +74 Mastery }
Local Finger1 Most Regal Signet of Sire Denathrius
ilevel: 233, stats: { +91 Sta, +178 Haste, +48 Mastery }, enchant: { +16 Mastery }
item effects: { equip: Denathrius' Privilege }
Local Finger2 Shadowghast Ring
ilevel: 235, stats: { +94 Sta, +115 Mastery, +115 Vers }, enchant: { +16 Mastery }
item effects: { equip: Temporal Warp }
Local Trinket1 Cabalist's Hymnal
ilevel: 226, stats: { +77 Int }
item effects: { equip: Crimson Chorus }
Local Trinket2 Sinful Aspirant's Badge of Ferocity
ilevel: 207, stats: { +91 Haste }
item effects: { use: Gladiator's Badge }
Local Back Mantle of Manifest Sins
ilevel: 226, stats: { 40 Armor, +84 Sta, +53 Crit, +26 Mastery, +46 StrAgiInt }
Local Main Hand Staff of the Penitent
ilevel: 226, weapon: { 93 - 128, 3.6 }, stats: { +82 Int, +281 Int, +149 Sta, +49 Crit, +93 Vers }, enchant: sinful_revelation

Profile

mage="Venthyr_Theotar"
source=default
spec=arcane
level=60
race=troll
role=spell
position=back
talents=1031021
talent_override=resonance,if=3>2
covenant=venthyr
soulbind=336239//51:6

# Default consumables
potion=deathly_fixation
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=variable,name=prepull_evo,op=reset,default=0
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
actions.precombat+=/variable,name=have_opened,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
actions.precombat+=/variable,name=final_burn,op=set,value=0
actions.precombat+=/variable,name=rs_max_delay,op=reset,default=5
actions.precombat+=/variable,name=ap_max_delay,op=reset,default=10
actions.precombat+=/variable,name=rop_max_delay,op=reset,default=20
actions.precombat+=/variable,name=totm_max_delay,op=reset,default=5
actions.precombat+=/variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
actions.precombat+=/variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
actions.precombat+=/variable,name=barrage_mana_pct,op=reset,default=70
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=reset,default=30
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
actions.precombat+=/variable,name=totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=aoe_totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=am_spam,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
actions.precombat+=/variable,name=am_spam_evo_pct,op=reset,default=15
actions.precombat+=/flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_familiar
actions.precombat+=/arcane_intellect
actions.precombat+=/conjure_mana_gem
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/frostbolt,if=variable.prepull_evo<=0
actions.precombat+=/evocation,if=variable.prepull_evo>0

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/call_action_list,name=shared_cds
actions+=/call_action_list,name=essences
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/call_action_list,name=opener,if=variable.have_opened<=0
actions+=/call_action_list,name=am_spam,if=variable.am_spam=1
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=rotation,if=variable.final_burn=0
actions+=/call_action_list,name=final_burn,if=variable.final_burn=1
actions+=/call_action_list,name=movement

actions.am_spam=cancel_action,if=action.evocation.channeling&mana.pct>=95
actions.am_spam+=/evocation,if=mana.pct<=variable.am_spam_evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/rune_of_power,if=buff.rune_of_power.down&cooldown.arcane_power.remains>0
actions.am_spam+=/touch_of_the_magi,if=(cooldown.arcane_power.remains=0&buff.rune_of_power.down)|prev_gcd.1.rune_of_power
actions.am_spam+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&buff.rune_of_power.down&essence.vision_of_perfection.enabled
actions.am_spam+=/arcane_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.ap_max_delay
actions.am_spam+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=action.arcane_missiles.execute_time&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_barrage,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_missiles,if=buff.clearcasting.react,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/arcane_missiles,if=!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.am_spam+=/arcane_barrage
actions.am_spam+=/arcane_blast

actions.aoe=frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
actions.aoe+=/arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
actions.aoe+=/mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
actions.aoe+=/arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
actions.aoe+=/rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
actions.aoe+=/presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
actions.aoe+=/arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
actions.aoe+=/supernova
actions.aoe+=/arcane_orb,if=buff.arcane_charge.stack=0
actions.aoe+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
actions.aoe+=/arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1

# Prioritize using grisly icicle with ap. Use it with totm otherwise.
actions.cooldowns=frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.cooldowns+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
# Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
# Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
actions.cooldowns+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
# Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
# Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
# Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
actions.cooldowns+=/arcane_power,if=(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
actions.cooldowns+=/rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
# Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
actions.cooldowns+=/presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
# Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.cooldowns+=/presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled

actions.essences=blood_of_the_enemy,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/blood_of_the_enemy,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains>=50&cooldown.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay
actions.essences+=/worldvein_resonance,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/guardian_of_azeroth,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/guardian_of_azeroth,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/concentrated_flame,line_cd=6,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/reaping_flames,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/focused_azerite_beam,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/purifying_blast,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/ripple_in_space,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/the_unbound_force,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/memory_of_lucid_dreams,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down

actions.final_burn=arcane_missiles,if=buff.clearcasting.react,chain=1
actions.final_burn+=/arcane_blast
actions.final_burn+=/arcane_barrage

actions.movement=blink_any,if=movement.distance>=10
actions.movement+=/presence_of_mind
actions.movement+=/arcane_missiles,if=movement.distance<10
actions.movement+=/arcane_orb
actions.movement+=/fire_blast

actions.opener=variable,name=have_opened,op=set,value=1,if=prev_gcd.1.evocation
actions.opener+=/fire_blast,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command_frost.up
actions.opener+=/frost_nova,if=runeforge.grisly_icicle.equipped&mana.pct>95
actions.opener+=/mirrors_of_torment
actions.opener+=/deathborne
actions.opener+=/radiant_spark,if=mana.pct>40
actions.opener+=/cancel_action,if=action.shifting_power.channeling&gcd.remains=0
actions.opener+=/shifting_power,if=soulbind.field_of_blossoms.enabled
actions.opener+=/touch_of_the_magi
actions.opener+=/arcane_power
actions.opener+=/rune_of_power,if=buff.rune_of_power.down
actions.opener+=/presence_of_mind
actions.opener+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.opener+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.opener+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.opener+=/arcane_missiles,if=buff.clearcasting.react,chain=1
actions.opener+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges&(cooldown.arcane_power.remains>10|active_enemies<=2)
actions.opener+=/arcane_blast,if=buff.rune_of_power.up|mana.pct>15
actions.opener+=/evocation,if=buff.rune_of_power.down,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.opener+=/arcane_barrage

actions.rotation=variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
actions.rotation+=/strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
actions.rotation+=/arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
actions.rotation+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.rotation+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.rotation+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
actions.rotation+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
actions.rotation+=/supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.rotation+=/arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
actions.rotation+=/arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_blast
actions.rotation+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.rotation+=/arcane_barrage

actions.shared_cds=use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
actions.shared_cds+=/use_items,if=buff.arcane_power.up
actions.shared_cds+=/potion,if=buff.arcane_power.up
actions.shared_cds+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
actions.shared_cds+=/lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/berserking,if=buff.arcane_power.up
actions.shared_cds+=/blood_fury,if=buff.arcane_power.up
actions.shared_cds+=/fireblood,if=buff.arcane_power.up
actions.shared_cds+=/ancestral_call,if=buff.arcane_power.up

head=confidants_favored_cap,id=183021,bonus_id=1498,ilevel=226
neck=nobles_birthstone_pendant,id=183039,bonus_id=1498,ilevel=226
shoulders=shawl_of_the_penitent,id=183020,bonus_id=1498,ilevel=233
back=mantle_of_manifest_sins,id=183033,bonus_id=1498,ilevel=226
chest=robes_of_the_cursed_commando,id=182998,bonus_id=1498,ilevel=233,enchant=eternal_insight
wrists=acolytes_velvet_bindings,id=183017,bonus_id=1498,ilevel=226,enchant=eternal_intellect
hands=impossibly_oversized_mitts,id=183022,bonus_id=1498,ilevel=226
waist=cinch_of_infinite_tightness,id=183028,bonus_id=1498,ilevel=226
legs=courtiers_costume_trousers,id=183011,bonus_id=1498,ilevel=226
feet=slippers_of_the_forgotten_heretic,id=182979,bonus_id=1498,ilevel=226
finger1=most_regal_signet_of_sire_denathrius,id=183036,bonus_id=1498,ilevel=233,enchant=16mastery
finger2=shadowghast_ring,id=178926,bonus_id=6648/6650/6758/6834/1532,ilevel=235,enchant=16mastery
trinket1=cabalists_hymnal,id=184028,bonus_id=1498,ilevel=226
trinket2=sinful_aspirants_badge_of_ferocity,id=175884,bonus_id=1521,ilevel=207
main_hand=staff_of_the_penitent,id=180000,bonus_id=7187/6652/1524,ilevel=226,enchant=sinful_revelation

# Gear Summary
# gear_ilvl=226.73
# gear_stamina=1504
# gear_intellect=1066
# gear_crit_rating=376
# gear_haste_rating=520
# gear_mastery_rating=733
# gear_versatility_rating=319
# gear_armor=369

arcane : 8282 dps, 3498 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
8281.6 8281.6 10.8 / 0.130% 793.1 / 9.6% 3.7
RPS Out RPS In Primary Resource Waiting APM Active Skill
2215.8 2104.6 Mana 0.00% 53.4 100.0% 100%
Talents
Runeforge

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
arcane 8282
Arcane Barrage 3219 38.9% 60.4 4.98sec 15983 13613 Direct 180.8 4464 9126 5336 18.7%

Stats Details: Arcane Barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 60.37 180.82 0.00 0.00 1.1742 0.0000 964871.82 964871.82 0.00% 13612.56 13612.56
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.27% 146.96 103 190 4463.66 2155 14549 4467.34 4048 4846 655925 655925 0.00%
crit 18.73% 33.86 14 57 9126.34 4309 29099 9129.48 6222 12714 308947 308947 0.00%

Action Details: Arcane Barrage

  • id:44425
  • school:arcane
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.728000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=0 + 72.8%} Arcane damage. For each Arcane Charge, deals {$36032s2=30}% additional damage$?a321526[, grants you {$321526s1=2}% of your maximum mana,][]$?a231564[ and hits {$36032s3=0} additional nearby $Ltarget:targets; for {$s2=40}% of its damage][]. |cFFFFFFFFConsumes all Arcane Charges.|r

Action Priority List

    aoe
    [o]:60.36
  • if_expr:buff.arcane_charge.stack=buff.arcane_charge.max_stack
Arcane Explosion 3840 46.4% 166.7 1.78sec 6906 5951 Direct 500.2 1927 3943 2302 18.6%

Stats Details: Arcane Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 166.73 500.20 0.00 0.00 1.1605 0.0000 1151506.17 1151506.17 0.00% 5951.15 5951.15
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.38% 407.07 315 508 1927.08 1427 3855 1928.15 1836 2045 784368 784368 0.00%
crit 18.62% 93.13 56 138 3942.81 2855 7710 3945.43 3491 4563 367138 367138 0.00%

Action Details: Arcane Explosion

  • id:1449
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.502320
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s2=0 + 50.2%} Arcane damage to all enemies within $A2 yards.$?a137021[ |cFFFFFFFFGenerates {$s1=1} Arcane Charge if any targets are hit.|r][]

Action Priority List

    aoe
    [n]:166.72
  • if_expr:buff.arcane_charge.stack<buff.arcane_charge.max_stack
Arcane Orb 0 (648) 0.0% (7.8%) 13.3 23.35sec 14649 12230

Stats Details: Arcane Orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.27 0.00 0.00 0.00 1.1978 0.0000 0.00 0.00 0.00% 12230.33 12230.33

Action Details: Arcane Orb

  • id:153626
  • school:arcane
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:153626
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r

Action Priority List

    aoe
    [m]:13.27
  • if_expr:buff.arcane_charge.stack=0
    Arcane Orb (_bolt) 648 7.8% 39.7 23.36sec 4894 0 Direct 39.7 4100 8434 4894 18.3%

Stats Details: Arcane Orb Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.73 39.73 0.00 0.00 0.0000 0.0000 194401.06 194401.06 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.66% 32.44 18 45 4099.77 2821 7619 4098.97 3445 4626 132952 132952 0.00%
crit 18.34% 7.29 1 16 8433.98 5642 15237 8423.30 5642 14375 61450 61450 0.00%

Action Details: Arcane Orb Bolt

  • id:153640
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.092000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:153640
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:{$@spelldesc153626=Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r}
Deathly Fixation 0 (85) 0.0% (1.0%) 18.5 1.35sec 1367 0

Stats Details: Deathly Fixation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.50 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Deathly Fixation

  • id:322253
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:42.90
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322253
  • name:Deathly Fixation
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1.
  • description:Deal {$s1=43} Shadow damage every $t1. Stacks up to 5 times.
    Deathly Eruption 85 1.0% 18.5 1.35sec 1367 0 Direct 18.5 1136 2275 1367 20.3%

Stats Details: Deathly Eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.50 18.50 0.00 0.00 0.0000 0.0000 25292.15 25292.15 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.72% 14.75 7 25 1136.05 1117 1184 1135.98 1117 1184 16755 16755 0.00%
crit 20.28% 3.75 0 11 2274.55 2233 2367 2232.05 0 2367 8537 8537 0.00%

Action Details: Deathly Eruption

  • id:322256
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:984.99
  • base_dd_max:984.99
  • base_dd_mult:1.00

Spelldata

  • id:322256
  • name:Deathly Eruption
  • school:shadow
  • tooltip:
  • description:Deal {$s1=985} Shadow damage.
Eternal Insight 39 0.5% 21.3 13.54sec 550 0 Direct 21.3 464 929 550 18.5%

Stats Details: Eternal Insight

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 21.25 21.25 0.00 0.00 0.0000 0.0000 11699.64 11699.64 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.47% 17.31 6 32 464.42 453 481 464.40 453 478 8041 8041 0.00%
crit 18.53% 3.94 0 11 928.69 907 961 910.28 0 961 3658 3658 0.00%

Action Details: Eternal Insight

  • id:342314
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:400.00
  • base_dd_max:400.00
  • base_dd_mult:1.00

Spelldata

  • id:342314
  • name:Eternal Insight
  • school:shadow
  • tooltip:
  • description:Deals {$s1=400} Shadow damage.
Frostbolt 4 0.0% 0.0 0.00sec 0 0 Direct 1.0 1024 2047 1172 14.6%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 1.00 0.00 0.00 0.0000 0.0000 1173.48 1173.48 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 85.37% 0.85 0 1 1023.69 1024 1024 873.90 0 1024 874 874 0.00%
crit 14.63% 0.15 0 1 2047.39 2047 2047 299.58 0 2047 300 300 0.00%

Action Details: Frostbolt

  • id:116
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.511000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116
  • name:Frostbolt
  • school:frost
  • tooltip:
  • description:Launches a bolt of frost at the enemy, causing {$228597s1=0} Frost damage and slowing movement speed by {$205708s1=50}% for {$205708d=8 seconds}.
Mirror Image 0 (19) 0.0% (0.2%) 1.0 0.00sec 5702 0

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.
    Frostbolt (mirror_image) 143  / 19 0.2% 117.0 0.99sec 49 48 Direct 117.0 41 82 49 20.0%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 117.00 117.00 0.00 0.00 1.0091 0.0000 5701.51 5701.51 0.00% 48.29 48.29
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.03% 93.63 78 106 40.54 30 51 40.54 39 42 3796 3796 0.00%
crit 19.97% 23.37 11 39 81.55 59 101 81.54 69 91 1906 1906 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:40.00
Touch of the Magi 0 (426) 0.0% (5.1%) 6.2 51.52sec 20498 15984

Stats Details: Touch Of The Magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.23 0.00 0.00 0.00 1.2825 0.0000 0.00 0.00 0.00% 15984.11 15984.11

Action Details: Touch Of The Magi

  • id:321507
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:4.0

Spelldata

  • id:321507
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]

Action Priority List

    aoe
    [j]:6.25
  • if_expr:buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
    Touch of the Magi (_explosion) 426 5.1% 6.2 51.42sec 20498 0 Direct 18.6 6858 0 6858 0.0%

Stats Details: Touch Of The Magi Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.23 18.64 0.00 0.00 0.0000 0.0000 127744.99 127744.99 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 18.64 15 21 6857.61 1088 32365 6845.86 4926 9933 127745 127745 0.00%

Action Details: Touch Of The Magi Explosion

  • id:210833
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8243.11
  • base_dd_max:8243.11
  • base_dd_mult:1.00

Spelldata

  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc321507=Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]}
Simple Action Stats Execute Interval
arcane
Arcane Power 2.9 127.00sec

Stats Details: Arcane Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.88 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Power

  • id:12042
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].

Action Priority List

    aoe
    [k]:2.88
  • if_expr:((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
Berserking 1.9 254.01sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.88 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    shared_cds
    [u]:1.88
  • if_expr:buff.arcane_power.up
Conjure Mana Gem 1.0 0.00sec

Stats Details: Conjure Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Conjure Mana Gem

  • id:759
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:9000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:759
  • name:Conjure Mana Gem
  • school:arcane
  • tooltip:
  • description:Conjures a Mana Gem that can be used to instantly restore {$5405s1=10}% mana, and holds up to {$s2=3} charges. $@spellname118812 {$@spelldesc118812=Conjured items disappear if logged out for more than 15 minutes.}
Evocation 1.2 222.07sec

Stats Details: Evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.17 0.00 6.91 0.00 4.1411 0.6960 0.00 0.00 0.00% 0.00 0.00

Action Details: Evocation

  • id:12051
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:arcane
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.

Action Priority List

    aoe
    [p]:1.16
  • interrupt_if_expr:mana.pct>=85
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:arcane
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:arcane
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Deathly Fixation (potion) 1.0 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307497
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    shared_cds
    [s]:1.00
  • if_expr:buff.arcane_power.up
Rune of Power 6.1 50.43sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.10 0.00 0.00 0.00 1.1959 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    aoe
    [l]:6.12
  • if_expr:buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Time Warp 1.5 300.08sec

Stats Details: Time Warp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.49 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Time Warp

  • id:80353
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:2000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:80353
  • name:Time Warp
  • school:arcane
  • tooltip:Haste increased by $w1%. $?$W4>0[Time rate increased by $w4%.][]$?$W3=1[ When the effect ends, you die.][]
  • description:Warp the flow of time, increasing haste by {$s1=30}% $?a320919[and time rate by {$s4=0}% ][]for all party and raid members for {$d=40 seconds}. Allies will be unable to benefit from Bloodlust, Heroism, or Time Warp again for {$57724d=600 seconds}.$?a320920[ When the effect ends, you die.][]

Action Priority List

    shared_cds
    [t]:1.49
  • if_expr:runeforge.temporal_warp.equipped&buff.exhaustion.up
Replenish Mana (use_mana_gem) 2.8 124.19sec

Stats Details: Use Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.79 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Use Mana Gem

  • id:5405
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:arcane
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5405
  • name:Replenish Mana
  • school:physical
  • tooltip:Restoring $w2 mana every $t1 sec.
  • description:Restores {$s1=10}% mana.

Action Priority List

    shared_cds
    [q]:2.79
  • if_expr:(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Arcane Charge 61.1 164.8 4.9sec 1.3sec 3.6sec 74.11% 0.00% 0.9 (1.3) 0.0

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.8s / 12.1s
  • trigger_min/max:0.0s / 6.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 9.5s

Stack Uptimes

  • arcane_charge_1:19.03%
  • arcane_charge_2:16.65%
  • arcane_charge_3:16.95%
  • arcane_charge_4:21.48%

Spelldata

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 2.9 0.0 126.9sec 126.9sec 14.7sec 14.11% 0.00% 0.0 (0.0) 2.8

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:121.1s / 134.3s
  • trigger_min/max:121.1s / 134.3s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 15.0s

Stack Uptimes

  • arcane_power_1:14.11%

Spelldata

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Berserking 1.9 0.0 253.9sec 253.9sec 11.7sec 7.29% 7.13% 0.0 (0.0) 1.8

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:250.2s / 262.6s
  • trigger_min/max:250.2s / 262.6s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s

Stack Uptimes

  • berserking_1:7.29%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.51% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.51%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Clearcasting 26.5 0.1 11.0sec 10.9sec 1.8sec 16.06% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_clearcasting
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • clearcasting_1:15.94%
  • clearcasting_2:0.13%
  • clearcasting_3:0.01%

Spelldata

  • id:263725
  • name:Clearcasting
  • tooltip:Your next Arcane Missiles or Arcane Explosion costs no mana{$?s321758=false}[ and Arcane Missiles fires an additional missile][].
  • description:{$@spelldesc79684=For each ${$c*100/{$s1=200}} mana you spend, you have a 1% chance to gain Clearcasting, making your next Arcane Missiles or Arcane Explosion free and channel {$277726s1=20}% faster.$?a321758[ Arcane Missiles fires {$321758s2=1} additional missile.][]}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Crimson Chorus 5.4 0.0 60.8sec 60.8sec 28.6sec 51.82% 0.00% 0.0 (0.0) 4.9

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_crimson_chorus
  • max_stacks:3
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:60.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:10.00
  • associated item:Cabalist's Hymnal

Stat Details

  • stat:crit_rating
  • amount:95.00

Trigger Details

  • interval_min/max:60.0s / 64.8s
  • trigger_min/max:60.0s / 64.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • crimson_chorus_1:17.86%
  • crimson_chorus_2:17.27%
  • crimson_chorus_3:16.69%

Spelldata

  • id:344803
  • name:Crimson Chorus
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc344806=Join the Crimson Chorus. Every minute, your Critical Strike swells by ${{$s1=44}*3} over ${{$344803d=10 seconds}*3} sec. before returning to normal. This effect is increased by {$s2=5}% for each member of the Crimson Chorus in your party.}
  • max_stacks:3
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Evocation 1.2 0.0 222.7sec 222.7sec 4.1sec 1.60% 0.00% 4.6 (4.6) 0.0

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_evocation
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:7.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:1.00

Trigger Details

  • interval_min/max:91.1s / 309.8s
  • trigger_min/max:91.1s / 309.8s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 4.3s

Stack Uptimes

  • evocation_1:1.60%

Spelldata

  • id:12051
  • name:Evocation
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Gladiator's Badge 2.9 0.0 126.9sec 126.9sec 14.7sec 14.11% 0.00% 0.0 (0.0) 2.8

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_gladiators_badge
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Sinful Aspirant's Badge of Ferocity

Stat Details

  • stat:intellect
  • amount:342.00

Trigger Details

  • interval_min/max:121.1s / 134.3s
  • trigger_min/max:121.1s / 134.3s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 15.0s

Stack Uptimes

  • gladiators_badge_1:14.11%

Spelldata

  • id:345228
  • name:Gladiator's Badge
  • tooltip:Primary stat increased by $w1.
  • description:Increases primary stat by {$s1=252} for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:0.00%
Potion of Deathly Fixation 1.0 0.0 0.0sec 0.0sec 25.0sec 8.45% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_potion_of_deathly_fixation
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:25.0s / 25.0s

Stack Uptimes

  • potion_of_deathly_fixation_1:8.45%

Spelldata

  • id:307497
  • name:Potion of Deathly Fixation
  • tooltip:Chance to apply Deathly Fixation to your target.
  • description:Your damaging spells and abilities have a chance to apply Deathly Fixation to your target, dealing {$322253s1=43} Shadow damage over {$322253d=8 seconds} and stacking up to 5 times. Upon reaching 5 stacks, Deathly Fixation explodes, dealing {$322256s1=985} Shadow damage to the target. If you consume this potion while your weapon is augmented with Shadowcore Oil, the explosion damage is increased by {$s2=10}%. Lasts {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Rune of Power 9.0 0.0 34.6sec 34.6sec 11.8sec 35.29% 0.00% 0.0 (0.0) 8.7

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.0s / 53.6s
  • trigger_min/max:13.0s / 53.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • rune_of_power_1:35.29%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Temporal Warp 1.5 0.0 300.1sec 300.1sec 35.3sec 17.27% 0.00% 0.0 (0.0) 1.2

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_temporal_warp
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:300.0s / 301.2s
  • trigger_min/max:300.0s / 301.2s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 40.0s

Stack Uptimes

  • temporal_warp_1:17.27%

Spelldata

  • id:327355
  • name:Temporal Warp
  • tooltip:Haste increased by $w1%.
  • description:{$@spelldesc327351=While you have Temporal Displacement or other similar effects, you may use Time Warp to grant yourself {$327355s1=30}% Haste for {$327355d=40 seconds}.}
  • max_stacks:0
  • duration:40.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism)

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Benefit Avg % Min Max
Arcane Barrage Arcane Charge 4 100.00% 100.00% 100.00%
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 1.52% 0.35% 5.82% 0.8s 0.0s 4.7s
Conserve Phase 100.00% 100.00% 100.00% 299.9s 240.2s 360.0s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.0000.0000.000179.943120.203239.964
Evocation111.8831.134337.018212.080111.081337.018
Rune of Power5.7540.04020.49936.23119.58748.403
Touch of the Magi4.4540.00020.92029.09417.75946.875
Arcane Power4.9851.08214.26714.5433.08823.924
Arcane Barrage2.6260.0008.236159.590125.887193.458
Arcane Orb3.2440.00010.32343.28331.01864.248
Time Warp0.8950.0001.3031.3301.2962.475

Burn Phases

Burn phase duration tracks the amount of time spent in each burn phase. This is defined as the time between a start_burn_phase and stop_burn_phase action being executed. Note that "execute" burn phases, i.e., the final burn of a fight, is also included.

Burn Phase Duration
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Mana at burn start is the mana level recorded (in percentage of total mana) when a start_burn_phase command is executed.

Mana at Burn Start
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
arcane
mana_regen Mana 480.34 395820.76 62.72% 824.05 7666.69 1.90%
Evocation Mana 53.79 59314.94 9.40% 1102.65 0.00 0.00%
Mana Gem Mana 2.79 18801.85 2.98% 6736.57 0.00 0.00%
Arcane Barrage Mana 60.36 157186.12 24.91% 2603.97 5472.56 3.36%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 66365.7 2104.60 2215.80 13128.5 34012.4 197.3 67365.7
Usage Type Count Total Avg RPE APR
arcane
arcane_explosion Mana 166.7 639016.9 3832.8 3832.6 1.8
arcane_orb Mana 13.3 5933.9 447.1 447.1 32.8
time_warp Mana 1.5 2972.3 2000.0 1992.1 0.0
touch_of_the_magi Mana 6.2 15573.0 2500.0 2498.9 8.2

Statistics & Data Analysis

Fight Length
arcane Fight Length
Count 1319
Mean 299.94
Minimum 240.20
Maximum 359.96
Spread ( max - min ) 119.76
Range [ ( max - min ) / 2 * 100% ] 19.96%
DPS
arcane Damage Per Second
Count 1319
Mean 8281.62
Minimum 7707.73
Maximum 8971.17
Spread ( max - min ) 1263.44
Range [ ( max - min ) / 2 * 100% ] 7.63%
Standard Deviation 200.0895
5th Percentile 7976.47
95th Percentile 8624.84
( 95th Percentile - 5th Percentile ) 648.37
Mean Distribution
Standard Deviation 5.5094
95.00% Confidence Interval ( 8270.82 - 8292.41 )
Normalized 95.00% Confidence Interval ( 99.87% - 100.13% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 23
0.1% Error 2243
0.1 Scale Factor Error with Delta=300 342
0.05 Scale Factor Error with Delta=300 1368
0.01 Scale Factor Error with Delta=300 34177
Priority Target DPS
arcane Priority Target Damage Per Second
Count 1319
Mean 3497.72
Minimum 3158.63
Maximum 3990.96
Spread ( max - min ) 832.32
Range [ ( max - min ) / 2 * 100% ] 11.90%
Standard Deviation 120.0276
5th Percentile 3313.31
95th Percentile 3708.71
( 95th Percentile - 5th Percentile ) 395.40
Mean Distribution
Standard Deviation 3.3049
95.00% Confidence Interval ( 3491.24 - 3504.19 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 46
0.1% Error 4524
0.1 Scale Factor Error with Delta=300 123
0.05 Scale Factor Error with Delta=300 492
0.01 Scale Factor Error with Delta=300 12299
DPS(e)
arcane Damage Per Second (Effective)
Count 1319
Mean 8281.62
Minimum 7707.73
Maximum 8971.17
Spread ( max - min ) 1263.44
Range [ ( max - min ) / 2 * 100% ] 7.63%
Damage
arcane Damage
Count 1319
Mean 2476689.31
Minimum 1889222.15
Maximum 2986062.66
Spread ( max - min ) 1096840.51
Range [ ( max - min ) / 2 * 100% ] 22.14%
DTPS
arcane Damage Taken Per Second
Count 1319
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
arcane Healing Per Second
Count 1319
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
arcane Healing Per Second (Effective)
Count 1319
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
arcane Heal
Count 1319
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
arcane Healing Taken Per Second
Count 1319
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
arcane Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
arcaneTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
arcane Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 variable,name=prepull_evo,op=reset,default=0
1 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
2 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
3 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
4 0.00 variable,name=have_opened,op=reset,default=0
5 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
6 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
7 0.00 variable,name=final_burn,op=set,value=0
8 0.00 variable,name=rs_max_delay,op=reset,default=5
9 0.00 variable,name=ap_max_delay,op=reset,default=10
A 0.00 variable,name=rop_max_delay,op=reset,default=20
B 0.00 variable,name=totm_max_delay,op=reset,default=5
C 0.00 variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
D 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
E 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
F 0.00 variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
G 0.00 variable,name=barrage_mana_pct,op=reset,default=70
H 0.00 variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
I 0.00 variable,name=ap_minimum_mana_pct,op=reset,default=30
J 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
K 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
L 0.00 variable,name=totm_max_charges,op=reset,default=2
M 0.00 variable,name=aoe_totm_max_charges,op=reset,default=2
N 0.00 variable,name=am_spam,op=reset,default=0
O 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
P 0.00 variable,name=am_spam_evo_pct,op=reset,default=15
Q 0.00 flask
R 0.00 food
S 0.00 augmentation
T 0.00 arcane_familiar
U 0.00 arcane_intellect
V 0.00 conjure_mana_gem
W 0.00 snapshot_stats
X 0.00 mirror_image
Y 0.00 frostbolt,if=variable.prepull_evo<=0
Z 0.00 evocation,if=variable.prepull_evo>0
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
a 0.00 call_action_list,name=shared_cds
b 0.00 call_action_list,name=essences
c 0.00 call_action_list,name=aoe,if=active_enemies>2
d 0.00 call_action_list,name=opener,if=variable.have_opened<=0
e 0.00 call_action_list,name=am_spam,if=variable.am_spam=1
f 0.00 call_action_list,name=cooldowns
g 0.00 call_action_list,name=rotation,if=variable.final_burn=0
h 0.00 call_action_list,name=final_burn,if=variable.final_burn=1
i 0.00 call_action_list,name=movement
actions.aoe
# count action,conditions
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
0.00 arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
0.00 mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
j 6.25 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
k 2.88 arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
l 6.12 rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
0.00 presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
0.00 arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
0.00 supernova
m 13.27 arcane_orb,if=buff.arcane_charge.stack=0
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
n 166.72 arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
0.00 arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
o 60.36 arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
p 1.16 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.shared_cds
# count action,conditions
q 2.79 use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
r 2.88 use_items,if=buff.arcane_power.up
s 1.00 potion,if=buff.arcane_power.up
t 1.49 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
0.00 lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
u 1.88 berserking,if=buff.arcane_power.up
0.00 blood_fury,if=buff.arcane_power.up
0.00 fireblood,if=buff.arcane_power.up
0.00 ancestral_call,if=buff.arcane_power.up

Sample Sequence

045789ABGILMNPQRVXYjtkrsuomonnnnonnnnonnnnqlonnnnonnnnomonnnnonnnnonnnnonnnnonnpnnomonnnnojlonnnnonnnnomonnnnonnnnonnnnomonnnnojlonnnnonnnnkromonnnnonqnnnonnnnomonnnnojlonnnnonnnnomonnnnonnnnonnnnomonnnnojlonnnnonnnnomonnnnonnnnonnnnomonnnnojkruonqnnnonnnnomlonnnnonnnnonnnnomonnnnonntnnonnnnomonnjlonnnnonpnnnomonnnnonnnnonnnnonn

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 prepull_evo Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat 4 have_opened Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat 5 have_opened Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat 7 final_burn Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat 8 rs_max_delay Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat 9 ap_max_delay Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat A rop_max_delay Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat B totm_max_delay Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat G barrage_mana_pct Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat I ap_minimum_mana_pct Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat L totm_max_charges Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat M aoe_totm_max_charges Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat N am_spam Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat P am_spam_evo_pct Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat Q flask arcane 67365.7/67366: 100% mana
Pre precombat R food arcane 67365.7/67366: 100% mana
Pre precombat V conjure_mana_gem Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat X mirror_image Fluffy_Pillow 67365.7/67366: 100% mana
Pre precombat Y frostbolt Fluffy_Pillow 67365.7/67366: 100% mana
0:00.000 aoe j touch_of_the_magi Fluffy_Pillow 66365.7/67366: 99% mana
0:01.297 shared_cds t time_warp Fluffy_Pillow 64868.4/67366: 96% mana bloodlust, arcane_charge(4), crimson_chorus
0:01.297 aoe k arcane_power Fluffy_Pillow 62868.4/67366: 93% mana bloodlust, arcane_charge(4), temporal_warp, crimson_chorus
0:01.297 shared_cds r use_items Fluffy_Pillow 62868.4/67366: 93% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, crimson_chorus
0:01.297 shared_cds s potion Fluffy_Pillow 62868.4/67366: 93% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, crimson_chorus, gladiators_badge
0:01.297 shared_cds u berserking Fluffy_Pillow 62868.4/67366: 93% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:01.297 aoe o arcane_barrage Fluffy_Pillow 62868.4/67366: 93% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:02.052 aoe m arcane_orb Fluffy_Pillow 66580.3/67366: 99% mana bloodlust, berserking, arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:02.806 aoe o arcane_barrage Fluffy_Pillow 67346.1/67366: 100% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:03.559 aoe n arcane_explosion Fluffy_Pillow 67365.7/67366: 100% mana bloodlust, berserking, arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:04.314 aoe n arcane_explosion Fluffy_Pillow 65882.9/67366: 98% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:05.068 aoe n arcane_explosion Fluffy_Pillow 64398.8/67366: 96% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:05.822 aoe n arcane_explosion Fluffy_Pillow 62914.7/67366: 93% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:06.577 aoe o arcane_barrage Fluffy_Pillow 61431.9/67366: 91% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:07.330 aoe n arcane_explosion Fluffy_Pillow 65141.1/67366: 97% mana bloodlust, berserking, arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:08.084 aoe n arcane_explosion Fluffy_Pillow 63656.9/67366: 94% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:08.839 aoe n arcane_explosion Fluffy_Pillow 62174.2/67366: 92% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:09.593 aoe n arcane_explosion Fluffy_Pillow 60690.0/67366: 90% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, temporal_warp, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:10.345 aoe o arcane_barrage Fluffy_Pillow 59203.2/67366: 88% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:11.098 aoe n arcane_explosion Fluffy_Pillow 62912.4/67366: 93% mana bloodlust, berserking, arcane_power, rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:11.852 aoe n arcane_explosion Fluffy_Pillow 61428.2/67366: 91% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:12.606 aoe n arcane_explosion Fluffy_Pillow 59944.1/67366: 89% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:13.361 aoe n arcane_explosion Fluffy_Pillow 58461.3/67366: 87% mana bloodlust, arcane_charge(3), arcane_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:14.132 shared_cds q use_mana_gem arcane 57000.1/67366: 85% mana bloodlust, arcane_charge(4), arcane_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:14.132 aoe l rune_of_power Fluffy_Pillow 63736.7/67366: 95% mana bloodlust, arcane_charge(4), arcane_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:14.904 aoe o arcane_barrage Fluffy_Pillow 64776.8/67366: 96% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:15.674 aoe n arcane_explosion Fluffy_Pillow 67365.7/67366: 100% mana bloodlust, arcane_power, rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:16.444 aoe n arcane_explosion Fluffy_Pillow 65903.1/67366: 98% mana bloodlust, arcane_charge, rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation
0:17.213 aoe n arcane_explosion Fluffy_Pillow 61939.2/67366: 92% mana bloodlust, arcane_charge(2), rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation
0:17.985 aoe n arcane_explosion Fluffy_Pillow 57979.4/67366: 86% mana bloodlust, arcane_charge(3), rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation
0:18.754 aoe o arcane_barrage Fluffy_Pillow 54015.4/67366: 80% mana bloodlust, arcane_charge(4), rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation
0:19.525 aoe n arcane_explosion Fluffy_Pillow 57748.9/67366: 86% mana bloodlust, rune_of_power, temporal_warp, crimson_chorus(2), potion_of_deathly_fixation
0:20.295 aoe n arcane_explosion Fluffy_Pillow 53786.3/67366: 80% mana bloodlust, arcane_charge, rune_of_power, temporal_warp, crimson_chorus(3), potion_of_deathly_fixation
0:21.065 aoe n arcane_explosion Fluffy_Pillow 49823.7/67366: 74% mana bloodlust, arcane_charge(2), rune_of_power, temporal_warp, crimson_chorus(3), potion_of_deathly_fixation
0:21.836 aoe n arcane_explosion Fluffy_Pillow 45862.5/67366: 68% mana bloodlust, arcane_charge(3), rune_of_power, temporal_warp, crimson_chorus(3), potion_of_deathly_fixation
0:22.607 aoe o arcane_barrage Fluffy_Pillow 41901.3/67366: 62% mana bloodlust, arcane_charge(4), rune_of_power, temporal_warp, crimson_chorus(3), potion_of_deathly_fixation
0:23.376 aoe m arcane_orb Fluffy_Pillow 45632.0/67366: 68% mana bloodlust, rune_of_power, temporal_warp, crimson_chorus(3), potion_of_deathly_fixation
0:24.146 aoe o arcane_barrage Fluffy_Pillow 46169.4/67366: 69% mana bloodlust, arcane_charge(4), rune_of_power, temporal_warp, crimson_chorus(3), potion_of_deathly_fixation
0:24.915 aoe n arcane_explosion Fluffy_Pillow 49900.1/67366: 74% mana bloodlust, rune_of_power, temporal_warp, crimson_chorus(3), potion_of_deathly_fixation
0:25.685 aoe n arcane_explosion Fluffy_Pillow 45937.6/67366: 68% mana bloodlust, arcane_charge, rune_of_power, temporal_warp, crimson_chorus(3), potion_of_deathly_fixation
0:26.454 aoe n arcane_explosion Fluffy_Pillow 41973.6/67366: 62% mana bloodlust, arcane_charge(2), rune_of_power, temporal_warp, crimson_chorus(3)
0:27.223 aoe n arcane_explosion Fluffy_Pillow 38009.7/67366: 56% mana bloodlust, arcane_charge(3), temporal_warp, crimson_chorus(3)
0:27.991 aoe o arcane_barrage Fluffy_Pillow 34044.5/67366: 51% mana bloodlust, arcane_charge(4), temporal_warp, crimson_chorus(3)
0:28.761 aoe n arcane_explosion Fluffy_Pillow 37776.5/67366: 56% mana bloodlust, temporal_warp, crimson_chorus(3)
0:29.532 aoe n arcane_explosion Fluffy_Pillow 33815.3/67366: 50% mana bloodlust, arcane_charge, temporal_warp, crimson_chorus(3)
0:30.302 aoe n arcane_explosion Fluffy_Pillow 29852.7/67366: 44% mana bloodlust, arcane_charge(2), clearcasting, temporal_warp
0:31.073 aoe n arcane_explosion Fluffy_Pillow 30891.5/67366: 46% mana bloodlust, arcane_charge(3), temporal_warp
0:31.843 aoe o arcane_barrage Fluffy_Pillow 26929.0/67366: 40% mana bloodlust, arcane_charge(4), temporal_warp
0:32.612 aoe n arcane_explosion Fluffy_Pillow 30659.7/67366: 46% mana bloodlust, temporal_warp
0:33.383 aoe n arcane_explosion Fluffy_Pillow 26698.4/67366: 40% mana bloodlust, arcane_charge, temporal_warp
0:34.154 aoe n arcane_explosion Fluffy_Pillow 22737.2/67366: 34% mana bloodlust, arcane_charge(2), temporal_warp
0:34.922 aoe n arcane_explosion Fluffy_Pillow 18772.0/67366: 28% mana bloodlust, arcane_charge(3), temporal_warp
0:35.692 aoe o arcane_barrage Fluffy_Pillow 14809.4/67366: 22% mana bloodlust, arcane_charge(4), temporal_warp
0:36.464 aoe n arcane_explosion Fluffy_Pillow 18544.1/67366: 28% mana bloodlust, temporal_warp
0:37.235 aoe n arcane_explosion Fluffy_Pillow 14582.9/67366: 22% mana bloodlust, arcane_charge, temporal_warp
0:38.004 aoe n arcane_explosion Fluffy_Pillow 10619.0/67366: 16% mana bloodlust, arcane_charge(2), temporal_warp
0:38.775 aoe n arcane_explosion Fluffy_Pillow 6657.8/67366: 10% mana bloodlust, arcane_charge(3), temporal_warp
0:39.547 aoe o arcane_barrage Fluffy_Pillow 2697.9/67366: 4% mana bloodlust, arcane_charge(4), clearcasting, temporal_warp
0:40.317 aoe n arcane_explosion Fluffy_Pillow 6430.0/67366: 10% mana bloodlust, clearcasting, temporal_warp
0:41.087 aoe n arcane_explosion Fluffy_Pillow 7467.4/67366: 11% mana arcane_charge, temporal_warp
0:42.086 aoe p evocation arcane 3813.4/67366: 6% mana arcane_charge(2)
0:46.406 aoe n arcane_explosion Fluffy_Pillow 61023.0/67366: 91% mana arcane_charge(2)
0:47.707 aoe n arcane_explosion Fluffy_Pillow 57775.9/67366: 86% mana arcane_charge(3)
0:49.007 aoe o arcane_barrage Fluffy_Pillow 54527.4/67366: 81% mana arcane_charge(4)
0:50.306 aoe m arcane_orb Fluffy_Pillow 58972.2/67366: 88% mana
0:51.605 aoe o arcane_barrage Fluffy_Pillow 60222.3/67366: 89% mana arcane_charge(4)
0:52.904 aoe n arcane_explosion Fluffy_Pillow 64667.1/67366: 96% mana
0:54.202 aoe n arcane_explosion Fluffy_Pillow 61415.9/67366: 91% mana arcane_charge, clearcasting
0:55.501 aoe n arcane_explosion Fluffy_Pillow 63166.1/67366: 94% mana arcane_charge(2)
0:56.802 aoe n arcane_explosion Fluffy_Pillow 59919.0/67366: 89% mana arcane_charge(3)
0:58.099 aoe o arcane_barrage Fluffy_Pillow 56666.4/67366: 84% mana arcane_charge(4)
0:59.398 aoe j touch_of_the_magi Fluffy_Pillow 61111.2/67366: 91% mana
1:00.697 aoe l rune_of_power Fluffy_Pillow 60361.4/67366: 90% mana arcane_charge(4), crimson_chorus
1:01.995 aoe o arcane_barrage Fluffy_Pillow 62110.2/67366: 92% mana arcane_charge(4), rune_of_power, crimson_chorus
1:03.295 aoe n arcane_explosion Fluffy_Pillow 66556.3/67366: 99% mana rune_of_power, crimson_chorus
1:04.594 aoe n arcane_explosion Fluffy_Pillow 63306.5/67366: 94% mana arcane_charge, rune_of_power, crimson_chorus
1:05.893 aoe n arcane_explosion Fluffy_Pillow 60056.6/67366: 89% mana arcane_charge(2), rune_of_power, crimson_chorus
1:07.192 aoe n arcane_explosion Fluffy_Pillow 56806.8/67366: 84% mana arcane_charge(3), rune_of_power, crimson_chorus
1:08.492 aoe o arcane_barrage Fluffy_Pillow 53558.3/67366: 80% mana arcane_charge(4), rune_of_power, crimson_chorus
1:09.791 aoe n arcane_explosion Fluffy_Pillow 58003.1/67366: 86% mana rune_of_power, crimson_chorus
1:11.090 aoe n arcane_explosion Fluffy_Pillow 54753.3/67366: 81% mana arcane_charge, rune_of_power, crimson_chorus(2)
1:12.391 aoe n arcane_explosion Fluffy_Pillow 51506.1/67366: 76% mana arcane_charge(2), clearcasting, rune_of_power, crimson_chorus(2)
1:13.690 aoe n arcane_explosion Fluffy_Pillow 53256.3/67366: 79% mana arcane_charge(3), rune_of_power, crimson_chorus(2)
1:14.989 aoe o arcane_barrage Fluffy_Pillow 50006.4/67366: 74% mana arcane_charge(4), clearcasting, crimson_chorus(2)
1:16.287 aoe m arcane_orb Fluffy_Pillow 54449.9/67366: 81% mana clearcasting, crimson_chorus(2)
1:17.586 aoe o arcane_barrage Fluffy_Pillow 55700.0/67366: 83% mana arcane_charge(4), clearcasting, crimson_chorus(2)
1:18.886 aoe n arcane_explosion Fluffy_Pillow 60146.2/67366: 89% mana clearcasting, crimson_chorus(2)
1:20.185 aoe n arcane_explosion Fluffy_Pillow 61896.3/67366: 92% mana arcane_charge, crimson_chorus(2)
1:21.485 aoe n arcane_explosion Fluffy_Pillow 58647.9/67366: 87% mana arcane_charge(2), crimson_chorus(3)
1:22.784 aoe n arcane_explosion Fluffy_Pillow 55398.0/67366: 82% mana arcane_charge(3), crimson_chorus(3)
1:24.083 aoe o arcane_barrage Fluffy_Pillow 52148.2/67366: 77% mana arcane_charge(4), crimson_chorus(3)
1:25.381 aoe n arcane_explosion Fluffy_Pillow 56591.6/67366: 84% mana crimson_chorus(3)
1:26.679 aoe n arcane_explosion Fluffy_Pillow 53340.4/67366: 79% mana arcane_charge, crimson_chorus(3)
1:27.980 aoe n arcane_explosion Fluffy_Pillow 50093.3/67366: 74% mana arcane_charge(2), crimson_chorus(3)
1:29.282 aoe n arcane_explosion Fluffy_Pillow 46847.5/67366: 70% mana arcane_charge(3), crimson_chorus(3)
1:30.582 aoe o arcane_barrage Fluffy_Pillow 43599.0/67366: 65% mana arcane_charge(4), crimson_chorus(3)
1:31.881 aoe n arcane_explosion Fluffy_Pillow 48043.8/67366: 71% mana
1:33.179 aoe n arcane_explosion Fluffy_Pillow 44792.6/67366: 66% mana arcane_charge
1:34.479 aoe n arcane_explosion Fluffy_Pillow 41544.1/67366: 62% mana arcane_charge(2), clearcasting
1:35.777 aoe n arcane_explosion Fluffy_Pillow 43292.9/67366: 64% mana arcane_charge(3)
1:37.077 aoe o arcane_barrage Fluffy_Pillow 40044.4/67366: 59% mana arcane_charge(4)
1:38.377 aoe m arcane_orb Fluffy_Pillow 44490.6/67366: 66% mana
1:39.675 aoe o arcane_barrage Fluffy_Pillow 45739.4/67366: 68% mana arcane_charge(4)
1:40.974 aoe n arcane_explosion Fluffy_Pillow 50184.2/67366: 74% mana
1:42.274 aoe n arcane_explosion Fluffy_Pillow 46935.7/67366: 70% mana arcane_charge
1:43.574 aoe n arcane_explosion Fluffy_Pillow 43687.2/67366: 65% mana arcane_charge(2)
1:44.875 aoe n arcane_explosion Fluffy_Pillow 40440.1/67366: 60% mana arcane_charge(3)
1:46.175 aoe o arcane_barrage Fluffy_Pillow 37191.6/67366: 55% mana arcane_charge(4)
1:47.474 aoe j touch_of_the_magi Fluffy_Pillow 41636.3/67366: 62% mana
1:48.772 aoe l rune_of_power Fluffy_Pillow 40885.2/67366: 61% mana arcane_charge(4)
1:50.071 aoe o arcane_barrage Fluffy_Pillow 42635.3/67366: 63% mana arcane_charge(4), rune_of_power
1:51.369 aoe n arcane_explosion Fluffy_Pillow 47078.8/67366: 70% mana rune_of_power
1:52.669 aoe n arcane_explosion Fluffy_Pillow 43830.3/67366: 65% mana arcane_charge, rune_of_power
1:53.970 aoe n arcane_explosion Fluffy_Pillow 40583.1/67366: 60% mana arcane_charge(2), rune_of_power
1:55.269 aoe n arcane_explosion Fluffy_Pillow 37333.3/67366: 55% mana arcane_charge(3), rune_of_power
1:56.569 aoe o arcane_barrage Fluffy_Pillow 34084.8/67366: 51% mana arcane_charge(4), rune_of_power
1:57.868 aoe n arcane_explosion Fluffy_Pillow 38529.6/67366: 57% mana rune_of_power
1:59.167 aoe n arcane_explosion Fluffy_Pillow 35279.8/67366: 52% mana arcane_charge, rune_of_power
2:00.468 aoe n arcane_explosion Fluffy_Pillow 32032.6/67366: 48% mana arcane_charge(2), clearcasting, rune_of_power
2:01.768 aoe n arcane_explosion Fluffy_Pillow 33784.1/67366: 50% mana arcane_charge(3), rune_of_power
2:03.067 aoe k arcane_power Fluffy_Pillow 30534.3/67366: 45% mana arcane_charge(4), crimson_chorus
2:03.067 shared_cds r use_items Fluffy_Pillow 30534.3/67366: 45% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus
2:03.067 aoe o arcane_barrage Fluffy_Pillow 30534.3/67366: 45% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus, gladiators_badge
2:04.365 aoe m arcane_orb Fluffy_Pillow 34977.7/67366: 52% mana arcane_power, rune_of_power, crimson_chorus, gladiators_badge
2:05.665 aoe o arcane_barrage Fluffy_Pillow 36479.2/67366: 54% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus, gladiators_badge
2:06.963 aoe n arcane_explosion Fluffy_Pillow 40922.7/67366: 61% mana arcane_power, rune_of_power, crimson_chorus, gladiators_badge
2:08.261 aoe n arcane_explosion Fluffy_Pillow 40171.5/67366: 60% mana arcane_charge, arcane_power, rune_of_power, crimson_chorus, gladiators_badge
2:09.562 aoe n arcane_explosion Fluffy_Pillow 39424.3/67366: 59% mana arcane_charge(2), arcane_power, rune_of_power, crimson_chorus, gladiators_badge
2:10.860 aoe n arcane_explosion Fluffy_Pillow 38673.2/67366: 57% mana arcane_charge(3), arcane_power, rune_of_power, crimson_chorus, gladiators_badge
2:12.159 aoe o arcane_barrage Fluffy_Pillow 37923.3/67366: 56% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:13.459 aoe n arcane_explosion Fluffy_Pillow 42369.5/67366: 63% mana arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:14.759 shared_cds q use_mana_gem arcane 41621.0/67366: 62% mana arcane_charge, arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:14.759 aoe n arcane_explosion Fluffy_Pillow 48357.5/67366: 72% mana arcane_charge, arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:16.058 aoe n arcane_explosion Fluffy_Pillow 47607.7/67366: 71% mana arcane_charge(2), arcane_power, crimson_chorus(2), gladiators_badge
2:17.359 aoe n arcane_explosion Fluffy_Pillow 46860.6/67366: 70% mana arcane_charge(3), arcane_power, crimson_chorus(2), gladiators_badge
2:18.660 aoe o arcane_barrage Fluffy_Pillow 46113.4/67366: 68% mana arcane_charge(4), crimson_chorus(2)
2:19.960 aoe n arcane_explosion Fluffy_Pillow 50559.5/67366: 75% mana crimson_chorus(2)
2:21.260 aoe n arcane_explosion Fluffy_Pillow 47311.1/67366: 70% mana arcane_charge, clearcasting, crimson_chorus(2)
2:22.558 aoe n arcane_explosion Fluffy_Pillow 49059.9/67366: 73% mana arcane_charge(2), crimson_chorus(3)
2:23.859 aoe n arcane_explosion Fluffy_Pillow 45812.7/67366: 68% mana arcane_charge(3), crimson_chorus(3)
2:25.159 aoe o arcane_barrage Fluffy_Pillow 42564.2/67366: 63% mana arcane_charge(4), crimson_chorus(3)
2:26.459 aoe m arcane_orb Fluffy_Pillow 47010.4/67366: 70% mana crimson_chorus(3)
2:27.758 aoe o arcane_barrage Fluffy_Pillow 48260.5/67366: 72% mana arcane_charge(4), crimson_chorus(3)
2:29.058 aoe n arcane_explosion Fluffy_Pillow 52706.7/67366: 78% mana crimson_chorus(3)
2:30.358 aoe n arcane_explosion Fluffy_Pillow 49458.2/67366: 73% mana arcane_charge, crimson_chorus(3)
2:31.658 aoe n arcane_explosion Fluffy_Pillow 46209.7/67366: 69% mana arcane_charge(2), crimson_chorus(3)
2:32.959 aoe n arcane_explosion Fluffy_Pillow 42962.5/67366: 64% mana arcane_charge(3)
2:34.260 aoe o arcane_barrage Fluffy_Pillow 39715.4/67366: 59% mana arcane_charge(4)
2:35.562 aoe j touch_of_the_magi Fluffy_Pillow 44164.2/67366: 66% mana
2:36.862 aoe l rune_of_power Fluffy_Pillow 43415.7/67366: 64% mana arcane_charge(4)
2:38.163 aoe o arcane_barrage Fluffy_Pillow 45168.6/67366: 67% mana arcane_charge(4), rune_of_power
2:39.463 aoe n arcane_explosion Fluffy_Pillow 49614.7/67366: 74% mana rune_of_power
2:40.762 aoe n arcane_explosion Fluffy_Pillow 46364.9/67366: 69% mana arcane_charge, rune_of_power
2:42.062 aoe n arcane_explosion Fluffy_Pillow 43116.4/67366: 64% mana arcane_charge(2), rune_of_power
2:43.361 aoe n arcane_explosion Fluffy_Pillow 39866.6/67366: 59% mana arcane_charge(3), clearcasting, rune_of_power
2:44.660 aoe o arcane_barrage Fluffy_Pillow 41616.7/67366: 62% mana arcane_charge(4), rune_of_power
2:45.960 aoe n arcane_explosion Fluffy_Pillow 46062.9/67366: 68% mana rune_of_power
2:47.259 aoe n arcane_explosion Fluffy_Pillow 42813.0/67366: 64% mana arcane_charge, rune_of_power
2:48.558 aoe n arcane_explosion Fluffy_Pillow 39563.2/67366: 59% mana arcane_charge(2), rune_of_power
2:49.857 aoe n arcane_explosion Fluffy_Pillow 36313.3/67366: 54% mana arcane_charge(3), rune_of_power
2:51.156 aoe o arcane_barrage Fluffy_Pillow 33063.5/67366: 49% mana arcane_charge(4)
2:52.456 aoe m arcane_orb Fluffy_Pillow 37509.6/67366: 56% mana
2:53.756 aoe o arcane_barrage Fluffy_Pillow 38761.1/67366: 58% mana arcane_charge(4)
2:55.056 aoe n arcane_explosion Fluffy_Pillow 43207.3/67366: 64% mana
2:56.356 aoe n arcane_explosion Fluffy_Pillow 39958.8/67366: 59% mana arcane_charge
2:57.654 aoe n arcane_explosion Fluffy_Pillow 36707.6/67366: 54% mana arcane_charge(2), clearcasting
2:58.953 aoe n arcane_explosion Fluffy_Pillow 38457.8/67366: 57% mana arcane_charge(3)
3:00.253 aoe o arcane_barrage Fluffy_Pillow 35209.3/67366: 52% mana arcane_charge(4)
3:01.553 aoe n arcane_explosion Fluffy_Pillow 39655.4/67366: 59% mana
3:02.852 aoe n arcane_explosion Fluffy_Pillow 36405.6/67366: 54% mana arcane_charge
3:04.151 aoe n arcane_explosion Fluffy_Pillow 33155.7/67366: 49% mana arcane_charge(2), crimson_chorus
3:05.451 aoe n arcane_explosion Fluffy_Pillow 29907.2/67366: 44% mana arcane_charge(3), crimson_chorus
3:06.751 aoe o arcane_barrage Fluffy_Pillow 26658.8/67366: 40% mana arcane_charge(4), crimson_chorus
3:08.051 aoe n arcane_explosion Fluffy_Pillow 31104.9/67366: 46% mana crimson_chorus
3:09.351 aoe n arcane_explosion Fluffy_Pillow 27856.4/67366: 41% mana arcane_charge, crimson_chorus
3:10.650 aoe n arcane_explosion Fluffy_Pillow 24606.6/67366: 37% mana arcane_charge(2), crimson_chorus
3:11.949 aoe n arcane_explosion Fluffy_Pillow 21356.7/67366: 32% mana arcane_charge(3), crimson_chorus
3:13.249 aoe o arcane_barrage Fluffy_Pillow 18108.2/67366: 27% mana arcane_charge(4), crimson_chorus(2)
3:14.548 aoe m arcane_orb Fluffy_Pillow 22553.0/67366: 33% mana crimson_chorus(2)
3:15.848 aoe o arcane_barrage Fluffy_Pillow 23804.5/67366: 35% mana arcane_charge(4), crimson_chorus(2)
3:17.148 aoe n arcane_explosion Fluffy_Pillow 28250.7/67366: 42% mana crimson_chorus(2)
3:18.449 aoe n arcane_explosion Fluffy_Pillow 25003.5/67366: 37% mana arcane_charge, crimson_chorus(2)
3:19.749 aoe n arcane_explosion Fluffy_Pillow 21755.0/67366: 32% mana arcane_charge(2), crimson_chorus(2)
3:21.050 aoe n arcane_explosion Fluffy_Pillow 18507.9/67366: 27% mana arcane_charge(3), crimson_chorus(2)
3:22.348 aoe o arcane_barrage Fluffy_Pillow 15256.7/67366: 23% mana arcane_charge(4), clearcasting, crimson_chorus(2)
3:23.646 aoe j touch_of_the_magi Fluffy_Pillow 19700.1/67366: 29% mana clearcasting, crimson_chorus(3)
3:24.946 aoe l rune_of_power Fluffy_Pillow 18951.7/67366: 28% mana arcane_charge(4), clearcasting, crimson_chorus(3)
3:26.248 aoe o arcane_barrage Fluffy_Pillow 20705.9/67366: 31% mana arcane_charge(4), clearcasting, rune_of_power, crimson_chorus(3)
3:27.547 aoe n arcane_explosion Fluffy_Pillow 25150.6/67366: 37% mana clearcasting, rune_of_power, crimson_chorus(3)
3:28.848 aoe n arcane_explosion Fluffy_Pillow 26903.5/67366: 40% mana arcane_charge, rune_of_power, crimson_chorus(3)
3:30.145 aoe n arcane_explosion Fluffy_Pillow 23651.0/67366: 35% mana arcane_charge(2), rune_of_power, crimson_chorus(3)
3:31.445 aoe n arcane_explosion Fluffy_Pillow 20402.5/67366: 30% mana arcane_charge(3), rune_of_power, crimson_chorus(3)
3:32.745 aoe o arcane_barrage Fluffy_Pillow 17154.0/67366: 25% mana arcane_charge(4), rune_of_power, crimson_chorus(3)
3:34.044 aoe n arcane_explosion Fluffy_Pillow 21598.8/67366: 32% mana rune_of_power
3:35.344 aoe n arcane_explosion Fluffy_Pillow 18350.3/67366: 27% mana arcane_charge, clearcasting, rune_of_power
3:36.645 aoe n arcane_explosion Fluffy_Pillow 20103.1/67366: 30% mana arcane_charge(2), rune_of_power
3:37.943 aoe n arcane_explosion Fluffy_Pillow 16852.0/67366: 25% mana arcane_charge(3), clearcasting, rune_of_power
3:39.243 aoe o arcane_barrage Fluffy_Pillow 18603.5/67366: 28% mana arcane_charge(4)
3:40.543 aoe m arcane_orb Fluffy_Pillow 23049.6/67366: 34% mana
3:41.842 aoe o arcane_barrage Fluffy_Pillow 24299.8/67366: 36% mana arcane_charge(4)
3:43.142 aoe n arcane_explosion Fluffy_Pillow 28745.9/67366: 43% mana
3:44.441 aoe n arcane_explosion Fluffy_Pillow 25496.1/67366: 38% mana arcane_charge
3:45.740 aoe n arcane_explosion Fluffy_Pillow 22246.2/67366: 33% mana arcane_charge(2), clearcasting
3:47.040 aoe n arcane_explosion Fluffy_Pillow 23997.7/67366: 36% mana arcane_charge(3)
3:48.340 aoe o arcane_barrage Fluffy_Pillow 20749.2/67366: 31% mana arcane_charge(4), clearcasting
3:49.639 aoe n arcane_explosion Fluffy_Pillow 25194.0/67366: 37% mana clearcasting
3:50.937 aoe n arcane_explosion Fluffy_Pillow 26942.8/67366: 40% mana arcane_charge
3:52.237 aoe n arcane_explosion Fluffy_Pillow 23694.4/67366: 35% mana arcane_charge(2), clearcasting
3:53.537 aoe n arcane_explosion Fluffy_Pillow 25445.9/67366: 38% mana arcane_charge(3)
3:54.838 aoe o arcane_barrage Fluffy_Pillow 22198.7/67366: 33% mana arcane_charge(4)
3:56.136 aoe n arcane_explosion Fluffy_Pillow 26642.2/67366: 40% mana
3:57.437 aoe n arcane_explosion Fluffy_Pillow 23395.0/67366: 35% mana arcane_charge
3:58.735 aoe n arcane_explosion Fluffy_Pillow 20143.8/67366: 30% mana arcane_charge(2)
4:00.036 aoe n arcane_explosion Fluffy_Pillow 16896.7/67366: 25% mana arcane_charge(3)
4:01.335 aoe o arcane_barrage Fluffy_Pillow 13646.8/67366: 20% mana arcane_charge(4)
4:02.635 aoe m arcane_orb Fluffy_Pillow 18093.0/67366: 27% mana
4:03.936 aoe o arcane_barrage Fluffy_Pillow 19345.8/67366: 29% mana arcane_charge(4), crimson_chorus
4:05.236 aoe n arcane_explosion Fluffy_Pillow 23792.0/67366: 35% mana crimson_chorus
4:06.535 aoe n arcane_explosion Fluffy_Pillow 20542.1/67366: 30% mana arcane_charge, crimson_chorus
4:07.834 aoe n arcane_explosion Fluffy_Pillow 17292.3/67366: 26% mana arcane_charge(2), crimson_chorus
4:09.132 aoe n arcane_explosion Fluffy_Pillow 14041.1/67366: 21% mana arcane_charge(3), clearcasting, crimson_chorus
4:10.432 aoe o arcane_barrage Fluffy_Pillow 15792.6/67366: 23% mana arcane_charge(4), crimson_chorus
4:11.731 aoe j touch_of_the_magi Fluffy_Pillow 20237.4/67366: 30% mana crimson_chorus
4:13.028 aoe k arcane_power Fluffy_Pillow 19484.9/67366: 29% mana arcane_charge(4), crimson_chorus
4:13.028 shared_cds r use_items Fluffy_Pillow 19484.9/67366: 29% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus
4:13.028 shared_cds u berserking Fluffy_Pillow 19484.9/67366: 29% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus, gladiators_badge
4:13.028 aoe o arcane_barrage Fluffy_Pillow 19484.9/67366: 29% mana berserking, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus, gladiators_badge
4:14.211 aoe n arcane_explosion Fluffy_Pillow 23773.4/67366: 35% mana berserking, arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:15.394 shared_cds q use_mana_gem arcane 22867.2/67366: 34% mana berserking, arcane_charge, arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:15.394 aoe n arcane_explosion Fluffy_Pillow 29603.8/67366: 44% mana berserking, arcane_charge, arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:16.578 aoe n arcane_explosion Fluffy_Pillow 28699.0/67366: 43% mana berserking, arcane_charge(2), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:17.761 aoe n arcane_explosion Fluffy_Pillow 27792.9/67366: 41% mana berserking, arcane_charge(3), arcane_power, clearcasting, rune_of_power, crimson_chorus(2), gladiators_badge
4:18.943 aoe o arcane_barrage Fluffy_Pillow 29385.4/67366: 44% mana berserking, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:20.125 aoe n arcane_explosion Fluffy_Pillow 33672.6/67366: 50% mana berserking, arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:21.308 aoe n arcane_explosion Fluffy_Pillow 32766.5/67366: 49% mana berserking, arcane_charge, arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:22.490 aoe n arcane_explosion Fluffy_Pillow 31859.0/67366: 47% mana berserking, arcane_charge(2), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:23.671 aoe n arcane_explosion Fluffy_Pillow 30950.2/67366: 46% mana berserking, arcane_charge(3), arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
4:24.854 aoe o arcane_barrage Fluffy_Pillow 30044.0/67366: 45% mana berserking, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
4:26.037 aoe m arcane_orb Fluffy_Pillow 34332.5/67366: 51% mana arcane_power, crimson_chorus(3), gladiators_badge
4:27.337 aoe l rune_of_power Fluffy_Pillow 35834.1/67366: 53% mana arcane_charge(4), arcane_power, crimson_chorus(3), gladiators_badge
4:28.636 aoe o arcane_barrage Fluffy_Pillow 37584.2/67366: 56% mana arcane_charge(4), rune_of_power, crimson_chorus(3)
4:29.935 aoe n arcane_explosion Fluffy_Pillow 42029.0/67366: 62% mana rune_of_power, crimson_chorus(3)
4:31.235 aoe n arcane_explosion Fluffy_Pillow 38780.5/67366: 58% mana arcane_charge, rune_of_power, crimson_chorus(3)
4:32.534 aoe n arcane_explosion Fluffy_Pillow 35530.7/67366: 53% mana arcane_charge(2), rune_of_power, crimson_chorus(3)
4:33.832 aoe n arcane_explosion Fluffy_Pillow 32279.5/67366: 48% mana arcane_charge(3), rune_of_power
4:35.132 aoe o arcane_barrage Fluffy_Pillow 29031.0/67366: 43% mana arcane_charge(4), rune_of_power
4:36.431 aoe n arcane_explosion Fluffy_Pillow 33475.8/67366: 50% mana rune_of_power
4:37.731 aoe n arcane_explosion Fluffy_Pillow 30227.3/67366: 45% mana arcane_charge, rune_of_power
4:39.032 aoe n arcane_explosion Fluffy_Pillow 26980.2/67366: 40% mana arcane_charge(2), rune_of_power
4:40.331 aoe n arcane_explosion Fluffy_Pillow 23730.3/67366: 35% mana arcane_charge(3), rune_of_power
4:41.630 aoe o arcane_barrage Fluffy_Pillow 20480.5/67366: 30% mana arcane_charge(4), clearcasting
4:42.928 aoe n arcane_explosion Fluffy_Pillow 24923.9/67366: 37% mana clearcasting
4:44.228 aoe n arcane_explosion Fluffy_Pillow 26675.4/67366: 40% mana arcane_charge
4:45.528 aoe n arcane_explosion Fluffy_Pillow 23426.9/67366: 35% mana arcane_charge(2)
4:46.827 aoe n arcane_explosion Fluffy_Pillow 20177.1/67366: 30% mana arcane_charge(3)
4:48.126 aoe o arcane_barrage Fluffy_Pillow 16927.3/67366: 25% mana arcane_charge(4)
4:49.425 aoe m arcane_orb Fluffy_Pillow 21372.0/67366: 32% mana
4:50.724 aoe o arcane_barrage Fluffy_Pillow 22622.2/67366: 34% mana arcane_charge(4)
4:52.023 aoe n arcane_explosion Fluffy_Pillow 27067.0/67366: 40% mana
4:53.323 aoe n arcane_explosion Fluffy_Pillow 23818.5/67366: 35% mana arcane_charge, clearcasting
4:54.624 aoe n arcane_explosion Fluffy_Pillow 25571.4/67366: 38% mana arcane_charge(2)
4:55.923 aoe n arcane_explosion Fluffy_Pillow 22321.5/67366: 33% mana arcane_charge(3)
4:57.221 aoe o arcane_barrage Fluffy_Pillow 19070.3/67366: 28% mana arcane_charge(4)
4:58.521 aoe n arcane_explosion Fluffy_Pillow 23516.5/67366: 35% mana
4:59.820 aoe n arcane_explosion Fluffy_Pillow 20266.6/67366: 30% mana arcane_charge
5:01.119 shared_cds t time_warp Fluffy_Pillow 17016.8/67366: 25% mana arcane_charge(2), clearcasting
5:01.297 aoe n arcane_explosion Fluffy_Pillow 15256.6/67366: 23% mana arcane_charge(2), clearcasting, temporal_warp
5:02.299 aoe n arcane_explosion Fluffy_Pillow 16606.6/67366: 25% mana arcane_charge(3), temporal_warp
5:03.300 aoe o arcane_barrage Fluffy_Pillow 12955.3/67366: 19% mana arcane_charge(4), clearcasting, temporal_warp
5:04.302 aoe n arcane_explosion Fluffy_Pillow 16999.9/67366: 25% mana clearcasting, temporal_warp, crimson_chorus
5:05.302 aoe n arcane_explosion Fluffy_Pillow 18347.2/67366: 27% mana arcane_charge, temporal_warp, crimson_chorus
5:06.300 aoe n arcane_explosion Fluffy_Pillow 14691.9/67366: 22% mana arcane_charge(2), temporal_warp, crimson_chorus
5:07.300 aoe n arcane_explosion Fluffy_Pillow 11039.2/67366: 16% mana arcane_charge(3), temporal_warp, crimson_chorus
5:08.301 aoe o arcane_barrage Fluffy_Pillow 7387.8/67366: 11% mana arcane_charge(4), clearcasting, temporal_warp, crimson_chorus
5:09.302 aoe m arcane_orb Fluffy_Pillow 11431.1/67366: 17% mana clearcasting, temporal_warp, crimson_chorus
5:10.425 aoe o arcane_barrage Fluffy_Pillow 12444.2/67366: 18% mana arcane_charge(4), clearcasting, temporal_warp, crimson_chorus
5:11.427 aoe n arcane_explosion Fluffy_Pillow 16488.8/67366: 24% mana clearcasting, temporal_warp, crimson_chorus
5:12.427 aoe n arcane_explosion Fluffy_Pillow 17836.1/67366: 26% mana arcane_charge, temporal_warp, crimson_chorus
5:13.428 aoe j touch_of_the_magi Fluffy_Pillow 14184.8/67366: 21% mana arcane_charge(2), temporal_warp, crimson_chorus(2)
5:14.429 aoe l rune_of_power Fluffy_Pillow 13033.4/67366: 19% mana arcane_charge(4), temporal_warp, crimson_chorus(2)
5:15.427 aoe o arcane_barrage Fluffy_Pillow 14378.1/67366: 21% mana arcane_charge(4), rune_of_power, temporal_warp, crimson_chorus(2)
5:16.428 aoe n arcane_explosion Fluffy_Pillow 18421.3/67366: 27% mana rune_of_power, temporal_warp, crimson_chorus(2)
5:17.428 aoe n arcane_explosion Fluffy_Pillow 14768.7/67366: 22% mana arcane_charge, rune_of_power, temporal_warp, crimson_chorus(2)
5:18.429 aoe n arcane_explosion Fluffy_Pillow 11117.3/67366: 17% mana arcane_charge(2), rune_of_power, temporal_warp, crimson_chorus(2)
5:19.430 aoe n arcane_explosion Fluffy_Pillow 7466.0/67366: 11% mana arcane_charge(3), rune_of_power, temporal_warp, crimson_chorus(2)
5:20.430 aoe o arcane_barrage Fluffy_Pillow 3813.3/67366: 6% mana arcane_charge(4), rune_of_power, temporal_warp, crimson_chorus(2)
5:21.429 aoe n arcane_explosion Fluffy_Pillow 7853.9/67366: 12% mana rune_of_power, temporal_warp, crimson_chorus(2)
5:22.430 aoe p evocation Fluffy_Pillow 4202.6/67366: 6% mana arcane_charge, rune_of_power, temporal_warp, crimson_chorus(2)
5:25.756 aoe n arcane_explosion Fluffy_Pillow 61426.8/67366: 91% mana arcane_charge, rune_of_power, temporal_warp, crimson_chorus(3)
5:26.756 aoe n arcane_explosion Fluffy_Pillow 57774.1/67366: 86% mana arcane_charge(2), clearcasting, rune_of_power, temporal_warp, crimson_chorus(3)
5:27.756 aoe n arcane_explosion Fluffy_Pillow 59121.4/67366: 88% mana arcane_charge(3), temporal_warp, crimson_chorus(3)
5:28.757 aoe o arcane_barrage Fluffy_Pillow 55470.1/67366: 82% mana arcane_charge(4), temporal_warp, crimson_chorus(3)
5:29.757 aoe m arcane_orb Fluffy_Pillow 59512.0/67366: 88% mana temporal_warp, crimson_chorus(3)
5:30.758 aoe o arcane_barrage Fluffy_Pillow 60360.7/67366: 90% mana arcane_charge(4), temporal_warp, crimson_chorus(3)
5:31.758 aoe n arcane_explosion Fluffy_Pillow 64402.6/67366: 96% mana temporal_warp, crimson_chorus(3)
5:32.755 aoe n arcane_explosion Fluffy_Pillow 60745.9/67366: 90% mana arcane_charge, temporal_warp, crimson_chorus(3)
5:33.756 aoe n arcane_explosion Fluffy_Pillow 57094.6/67366: 85% mana arcane_charge(2), temporal_warp
5:34.757 aoe n arcane_explosion Fluffy_Pillow 53443.2/67366: 79% mana arcane_charge(3), temporal_warp
5:35.757 aoe o arcane_barrage Fluffy_Pillow 49790.5/67366: 74% mana arcane_charge(4), temporal_warp
5:36.757 aoe n arcane_explosion Fluffy_Pillow 53832.5/67366: 80% mana temporal_warp
5:37.757 aoe n arcane_explosion Fluffy_Pillow 50179.8/67366: 74% mana arcane_charge, temporal_warp
5:38.757 aoe n arcane_explosion Fluffy_Pillow 46527.1/67366: 69% mana arcane_charge(2), temporal_warp
5:39.759 aoe n arcane_explosion Fluffy_Pillow 42877.1/67366: 64% mana arcane_charge(3), clearcasting, temporal_warp
5:40.760 aoe o arcane_barrage Fluffy_Pillow 44225.8/67366: 66% mana arcane_charge(4), temporal_warp
5:41.762 aoe n arcane_explosion Fluffy_Pillow 48270.4/67366: 72% mana
5:43.060 aoe n arcane_explosion Fluffy_Pillow 45019.2/67366: 67% mana arcane_charge, clearcasting
5:44.359 aoe n arcane_explosion Fluffy_Pillow 46769.4/67366: 69% mana arcane_charge(2)
5:45.658 aoe n arcane_explosion Fluffy_Pillow 43519.6/67366: 65% mana arcane_charge(3)
5:46.958 aoe o arcane_barrage Fluffy_Pillow 40271.1/67366: 60% mana arcane_charge(4)
5:48.257 aoe n arcane_explosion Fluffy_Pillow 44715.9/67366: 66% mana
5:49.556 aoe n arcane_explosion Fluffy_Pillow 41466.0/67366: 62% mana arcane_charge

Stats

Level Bonus (60) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 198 1 199 199 0
Agility 306 2 308 308 0
Stamina 414 0 2013 1918 1504
Intellect 450 -3 1767 1588 1066 (46)
Spirit 0 0 0 0 0
Health 40260 38360 0
Mana 67366 67366 0
Spell Power 1767 1588 0
Crit 15.74% 15.74% 376
Haste 15.76% 15.76% 520
Versatility 7.97% 7.97% 319
Mana Regen 1347 1347 0
Mastery 34.73% 34.73% 733
Armor 369 369 369
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 227.00
Local Head Confidant's Favored Cap
ilevel: 226, stats: { 44 Armor, +82 Int, +149 Sta, +44 Haste, +98 Mastery }
Local Neck Noble's Birthstone Pendant
ilevel: 226, stats: { +84 Sta, +52 Crit, +162 Mastery }
Local Shoulders Shawl of the Penitent
ilevel: 233, stats: { 42 Armor, +65 Int, +122 Sta, +33 Crit, +76 Haste }
Local Chest Robes of the Cursed Commando
ilevel: 233, stats: { 61 Armor, +87 Int, +162 Sta, +47 Crit, +100 Haste }, enchant: { +20 Int }
Local Waist Cinch of Infinite Tightness
ilevel: 226, stats: { 33 Armor, +61 Int, +112 Sta, +69 Crit, +36 Vers }
Local Legs Courtier's Costume Trousers
ilevel: 226, stats: { 51 Armor, +82 Int, +149 Sta, +49 Vers, +93 Mastery }
Local Feet Slippers of the Forgotten Heretic
ilevel: 226, stats: { 36 Armor, +61 Int, +112 Sta, +73 Crit, +32 Mastery }
Local Wrists Acolyte's Velvet Bindings
ilevel: 226, stats: { 29 Armor, +46 Int, +84 Sta, +26 Vers, +53 Mastery }, enchant: { +15 Int }
Local Hands Impossibly Oversized Mitts
ilevel: 226, stats: { 33 Armor, +61 Int, +112 Sta, +31 Haste, +74 Mastery }
Local Finger1 Most Regal Signet of Sire Denathrius
ilevel: 233, stats: { +91 Sta, +178 Haste, +48 Mastery }, enchant: { +16 Mastery }
item effects: { equip: Denathrius' Privilege }
Local Finger2 Shadowghast Ring
ilevel: 235, stats: { +94 Sta, +115 Mastery, +115 Vers }, enchant: { +16 Mastery }
item effects: { equip: Temporal Warp }
Local Trinket1 Cabalist's Hymnal
ilevel: 226, stats: { +77 Int }
item effects: { equip: Crimson Chorus }
Local Trinket2 Sinful Aspirant's Badge of Ferocity
ilevel: 207, stats: { +91 Haste }
item effects: { use: Gladiator's Badge }
Local Back Mantle of Manifest Sins
ilevel: 226, stats: { 40 Armor, +84 Sta, +53 Crit, +26 Mastery, +46 StrAgiInt }
Local Main Hand Staff of the Penitent
ilevel: 226, weapon: { 93 - 128, 3.6 }, stats: { +82 Int, +281 Int, +149 Sta, +49 Crit, +93 Vers }, enchant: sinful_revelation

Profile

mage="arcane"
source=default
spec=arcane
level=60
race=troll
role=spell
position=back
talents=1031021
talent_override=resonance,if=3>2

# Default consumables
potion=deathly_fixation
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=variable,name=prepull_evo,op=reset,default=0
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
actions.precombat+=/variable,name=have_opened,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
actions.precombat+=/variable,name=final_burn,op=set,value=0
actions.precombat+=/variable,name=rs_max_delay,op=reset,default=5
actions.precombat+=/variable,name=ap_max_delay,op=reset,default=10
actions.precombat+=/variable,name=rop_max_delay,op=reset,default=20
actions.precombat+=/variable,name=totm_max_delay,op=reset,default=5
actions.precombat+=/variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
actions.precombat+=/variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
actions.precombat+=/variable,name=barrage_mana_pct,op=reset,default=70
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=reset,default=30
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
actions.precombat+=/variable,name=totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=aoe_totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=am_spam,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
actions.precombat+=/variable,name=am_spam_evo_pct,op=reset,default=15
actions.precombat+=/flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_familiar
actions.precombat+=/arcane_intellect
actions.precombat+=/conjure_mana_gem
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/frostbolt,if=variable.prepull_evo<=0
actions.precombat+=/evocation,if=variable.prepull_evo>0

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/call_action_list,name=shared_cds
actions+=/call_action_list,name=essences
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/call_action_list,name=opener,if=variable.have_opened<=0
actions+=/call_action_list,name=am_spam,if=variable.am_spam=1
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=rotation,if=variable.final_burn=0
actions+=/call_action_list,name=final_burn,if=variable.final_burn=1
actions+=/call_action_list,name=movement

actions.am_spam=cancel_action,if=action.evocation.channeling&mana.pct>=95
actions.am_spam+=/evocation,if=mana.pct<=variable.am_spam_evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/rune_of_power,if=buff.rune_of_power.down&cooldown.arcane_power.remains>0
actions.am_spam+=/touch_of_the_magi,if=(cooldown.arcane_power.remains=0&buff.rune_of_power.down)|prev_gcd.1.rune_of_power
actions.am_spam+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&buff.rune_of_power.down&essence.vision_of_perfection.enabled
actions.am_spam+=/arcane_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.ap_max_delay
actions.am_spam+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=action.arcane_missiles.execute_time&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_barrage,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_missiles,if=buff.clearcasting.react,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/arcane_missiles,if=!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.am_spam+=/arcane_barrage
actions.am_spam+=/arcane_blast

actions.aoe=frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
actions.aoe+=/arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
actions.aoe+=/mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
actions.aoe+=/arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
actions.aoe+=/rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
actions.aoe+=/presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
actions.aoe+=/arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
actions.aoe+=/supernova
actions.aoe+=/arcane_orb,if=buff.arcane_charge.stack=0
actions.aoe+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
actions.aoe+=/arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1

# Prioritize using grisly icicle with ap. Use it with totm otherwise.
actions.cooldowns=frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.cooldowns+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
# Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
# Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
actions.cooldowns+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
# Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
# Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
# Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
actions.cooldowns+=/arcane_power,if=(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
actions.cooldowns+=/rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
# Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
actions.cooldowns+=/presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
# Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.cooldowns+=/presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled

actions.essences=blood_of_the_enemy,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/blood_of_the_enemy,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains>=50&cooldown.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay
actions.essences+=/worldvein_resonance,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/guardian_of_azeroth,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/guardian_of_azeroth,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/concentrated_flame,line_cd=6,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/reaping_flames,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/focused_azerite_beam,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/purifying_blast,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/ripple_in_space,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/the_unbound_force,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/memory_of_lucid_dreams,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down

actions.final_burn=arcane_missiles,if=buff.clearcasting.react,chain=1
actions.final_burn+=/arcane_blast
actions.final_burn+=/arcane_barrage

actions.movement=blink_any,if=movement.distance>=10
actions.movement+=/presence_of_mind
actions.movement+=/arcane_missiles,if=movement.distance<10
actions.movement+=/arcane_orb
actions.movement+=/fire_blast

actions.opener=variable,name=have_opened,op=set,value=1,if=prev_gcd.1.evocation
actions.opener+=/fire_blast,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command_frost.up
actions.opener+=/frost_nova,if=runeforge.grisly_icicle.equipped&mana.pct>95
actions.opener+=/mirrors_of_torment
actions.opener+=/deathborne
actions.opener+=/radiant_spark,if=mana.pct>40
actions.opener+=/cancel_action,if=action.shifting_power.channeling&gcd.remains=0
actions.opener+=/shifting_power,if=soulbind.field_of_blossoms.enabled
actions.opener+=/touch_of_the_magi
actions.opener+=/arcane_power
actions.opener+=/rune_of_power,if=buff.rune_of_power.down
actions.opener+=/presence_of_mind
actions.opener+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.opener+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.opener+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.opener+=/arcane_missiles,if=buff.clearcasting.react,chain=1
actions.opener+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges&(cooldown.arcane_power.remains>10|active_enemies<=2)
actions.opener+=/arcane_blast,if=buff.rune_of_power.up|mana.pct>15
actions.opener+=/evocation,if=buff.rune_of_power.down,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.opener+=/arcane_barrage

actions.rotation=variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
actions.rotation+=/strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
actions.rotation+=/arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
actions.rotation+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.rotation+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.rotation+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
actions.rotation+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
actions.rotation+=/supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.rotation+=/arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
actions.rotation+=/arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_blast
actions.rotation+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.rotation+=/arcane_barrage

actions.shared_cds=use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
actions.shared_cds+=/use_items,if=buff.arcane_power.up
actions.shared_cds+=/potion,if=buff.arcane_power.up
actions.shared_cds+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
actions.shared_cds+=/lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/berserking,if=buff.arcane_power.up
actions.shared_cds+=/blood_fury,if=buff.arcane_power.up
actions.shared_cds+=/fireblood,if=buff.arcane_power.up
actions.shared_cds+=/ancestral_call,if=buff.arcane_power.up

head=confidants_favored_cap,id=183021,bonus_id=1498,ilevel=226
neck=nobles_birthstone_pendant,id=183039,bonus_id=1498,ilevel=226
shoulders=shawl_of_the_penitent,id=183020,bonus_id=1498,ilevel=233
back=mantle_of_manifest_sins,id=183033,bonus_id=1498,ilevel=226
chest=robes_of_the_cursed_commando,id=182998,bonus_id=1498,ilevel=233,enchant=eternal_insight
wrists=acolytes_velvet_bindings,id=183017,bonus_id=1498,ilevel=226,enchant=eternal_intellect
hands=impossibly_oversized_mitts,id=183022,bonus_id=1498,ilevel=226
waist=cinch_of_infinite_tightness,id=183028,bonus_id=1498,ilevel=226
legs=courtiers_costume_trousers,id=183011,bonus_id=1498,ilevel=226
feet=slippers_of_the_forgotten_heretic,id=182979,bonus_id=1498,ilevel=226
finger1=most_regal_signet_of_sire_denathrius,id=183036,bonus_id=1498,ilevel=233,enchant=16mastery
finger2=shadowghast_ring,id=178926,bonus_id=6648/6650/6758/6834/1532,ilevel=235,enchant=16mastery
trinket1=cabalists_hymnal,id=184028,bonus_id=1498,ilevel=226
trinket2=sinful_aspirants_badge_of_ferocity,id=175884,bonus_id=1521,ilevel=207
main_hand=staff_of_the_penitent,id=180000,bonus_id=7187/6652/1524,ilevel=226,enchant=sinful_revelation

# Gear Summary
# gear_ilvl=226.73
# gear_stamina=1504
# gear_intellect=1066
# gear_crit_rating=376
# gear_haste_rating=520
# gear_mastery_rating=733
# gear_versatility_rating=319
# gear_armor=369

Simulation & Raid Information

Iterations: 1335
Threads: 16
Confidence: 95.00%
Fight Length (fixed time): 240 - 360 ( 299.9 )

Performance:

Total Events Processed: 38182130
Max Event Queue: 319
Sim Seconds: 400425
CPU Seconds: 59.6406
Physical Seconds: 10.5216
Speed Up: 6714

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Execute Count Crit% Avoid% G% B% Interval Combined Duration
Kyrian_Forgelite Kyrian_Forgelite arcane_barrage 44425 961080 3204 35.04 4601 9356 58.4 175.1 18.7% 0.0% 0.0% 0.0% 5.14sec 961080 299.94sec
Kyrian_Forgelite Kyrian_Forgelite arcane_explosion 1449 1110906 3704 95.92 1940 3966 159.8 479.5 18.6% 0.0% 0.0% 0.0% 1.85sec 1110906 299.94sec
Kyrian_Forgelite Kyrian_Forgelite arcane_orb 153626 0 0 0.00 0 0 13.2 0.0 0.0% 0.0% 0.0% 0.0% 23.44sec 0 299.94sec
Kyrian_Forgelite Kyrian_Forgelite arcane_orb_bolt 153640 198777 663 7.90 4212 8607 39.5 39.5 18.6% 0.0% 0.0% 0.0% 23.44sec 198777 299.94sec
Kyrian_Forgelite Kyrian_Forgelite arcane_power 12042 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 128.84sec 0 299.94sec
Kyrian_Forgelite Kyrian_Forgelite berserking 26297 0 0 0.00 0 0 1.8 0.0 0.0% 0.0% 0.0% 0.0% 258.08sec 0 299.94sec
Kyrian_Forgelite Kyrian_Forgelite conjure_mana_gem 759 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
Kyrian_Forgelite Kyrian_Forgelite deathly_fixation 322253 0 0 0.00 0 0 18.6 0.0 0.0% 0.0% 0.0% 0.0% 1.34sec 0 299.94sec
Kyrian_Forgelite Kyrian_Forgelite deathly_eruption 322256 25585 85 3.71 1137 2275 18.6 18.6 21.3% 0.0% 0.0% 0.0% 1.34sec 25585 299.94sec
Kyrian_Forgelite Kyrian_Forgelite eternal_insight 342314 11695 39 4.24 464 928 21.2 21.2 18.9% 0.0% 0.0% 0.0% 13.88sec 11695 299.94sec
Kyrian_Forgelite Kyrian_Forgelite evocation 12051 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 221.06sec 0 299.94sec
Kyrian_Forgelite Kyrian_Forgelite flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
Kyrian_Forgelite Kyrian_Forgelite food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
Kyrian_Forgelite Kyrian_Forgelite frostbolt 116 1184 4 0.20 1024 2047 0.0 1.0 15.6% 0.0% 0.0% 0.0% 0.00sec 1184 299.94sec
Kyrian_Forgelite Kyrian_Forgelite mirror_image 55342 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
Kyrian_Forgelite Kyrian_Forgelite_mirror_image frostbolt 59638 5748 144 175.50 41 83 117.0 117.0 19.8% 0.0% 0.0% 0.0% 0.99sec 5748 40.00sec
Kyrian_Forgelite Kyrian_Forgelite potion 307497 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
Kyrian_Forgelite Kyrian_Forgelite radiant_spark 307443 26242 87 1.81 2425 4981 9.1 9.1 18.4% 0.0% 0.0% 0.0% 34.50sec 42958 299.94sec
Kyrian_Forgelite Kyrian_Forgelite radiant_spark ticks -307443 16716 56 12.60 223 449 9.1 63.0 18.7% 0.0% 0.0% 0.0% 34.50sec 42958 299.94sec
Kyrian_Forgelite Kyrian_Forgelite rune_of_power 116011 0 0 0.00 0 0 6.0 0.0 0.0% 0.0% 0.0% 0.0% 51.32sec 0 299.94sec
Kyrian_Forgelite Kyrian_Forgelite time_warp 80353 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 300.61sec 0 299.94sec
Kyrian_Forgelite Kyrian_Forgelite touch_of_the_magi 321507 0 0 0.00 0 0 6.1 0.0 0.0% 0.0% 0.0% 0.0% 52.45sec 0 299.94sec
Kyrian_Forgelite Kyrian_Forgelite touch_of_the_magi_explosion 210833 197390 658 3.67 10755 0 6.1 18.4 0.0% 0.0% 0.0% 0.0% 52.35sec 197390 299.94sec
Kyrian_Forgelite Kyrian_Forgelite use_mana_gem 5405 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 124.52sec 0 299.94sec
Kyrian_Forgelite Kyrian_Forgelite_bron anima_cannon 332525 0 0 0.00 0 0 8.3 0.0 0.0% 0.0% 0.0% 0.0% 22.73sec 0 62.20sec
Kyrian_Forgelite Kyrian_Forgelite_bron goliath_support 332526 0 0 0.00 0 0 14.5 0.0 0.0% 0.0% 0.0% 0.0% 12.30sec 0 62.20sec
Kyrian_Forgelite Kyrian_Forgelite_bron melee 0 3558 57 20.04 148 295 20.8 20.8 16.0% 0.0% 0.0% 0.0% 8.36sec 5083 62.20sec
Kyrian_Forgelite Kyrian_Forgelite_bron smash 341163 0 0 0.00 0 0 8.2 0.0 0.0% 0.0% 0.0% 0.0% 22.72sec 0 62.20sec
Kyrian_Pelagos Kyrian_Pelagos arcane_barrage 44425 971341 3238 35.04 4643 9450 58.5 175.2 18.8% 0.0% 0.0% 0.0% 5.13sec 971341 299.94sec
Kyrian_Pelagos Kyrian_Pelagos arcane_explosion 1449 1126272 3755 96.04 1963 4007 160.0 480.1 18.7% 0.0% 0.0% 0.0% 1.85sec 1126272 299.94sec
Kyrian_Pelagos Kyrian_Pelagos arcane_orb 153626 0 0 0.00 0 0 13.2 0.0 0.0% 0.0% 0.0% 0.0% 23.46sec 0 299.94sec
Kyrian_Pelagos Kyrian_Pelagos arcane_orb_bolt 153640 203378 678 7.90 4314 8859 39.5 39.5 18.5% 0.0% 0.0% 0.0% 23.46sec 203378 299.94sec
Kyrian_Pelagos Kyrian_Pelagos arcane_power 12042 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 128.90sec 0 299.94sec
Kyrian_Pelagos Kyrian_Pelagos berserking 26297 0 0 0.00 0 0 1.8 0.0 0.0% 0.0% 0.0% 0.0% 258.31sec 0 299.94sec
Kyrian_Pelagos Kyrian_Pelagos conjure_mana_gem 759 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
Kyrian_Pelagos Kyrian_Pelagos deathly_fixation 322253 0 0 0.00 0 0 18.7 0.0 0.0% 0.0% 0.0% 0.0% 1.34sec 0 299.94sec
Kyrian_Pelagos Kyrian_Pelagos deathly_eruption 322256 25621 85 3.74 1137 2274 18.7 18.7 20.5% 0.0% 0.0% 0.0% 1.34sec 25621 299.94sec
Kyrian_Pelagos Kyrian_Pelagos eternal_insight 342314 11693 39 4.25 464 927 21.2 21.2 18.7% 0.0% 0.0% 0.0% 14.04sec 11693 299.94sec
Kyrian_Pelagos Kyrian_Pelagos evocation 12051 0 0 0.00 0 0 0.9 0.0 0.0% 0.0% 0.0% 0.0% 197.03sec 0 299.94sec
Kyrian_Pelagos Kyrian_Pelagos flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
Kyrian_Pelagos Kyrian_Pelagos food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
Kyrian_Pelagos Kyrian_Pelagos frostbolt 116 1189 4 0.20 1024 2047 0.0 1.0 16.1% 0.0% 0.0% 0.0% 0.00sec 1189 299.94sec
Kyrian_Pelagos Kyrian_Pelagos mirror_image 55342 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
Kyrian_Pelagos Kyrian_Pelagos_mirror_image frostbolt 59638 5745 144 175.50 41 83 117.0 117.0 19.7% 0.0% 0.0% 0.0% 0.99sec 5745 40.00sec
Kyrian_Pelagos Kyrian_Pelagos potion 307497 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
Kyrian_Pelagos Kyrian_Pelagos radiant_spark 307443 26453 88 1.81 2437 5025 9.0 9.0 18.8% 0.0% 0.0% 0.0% 34.54sec 43040 299.94sec
Kyrian_Pelagos Kyrian_Pelagos radiant_spark ticks -307443 16586 55 12.57 222 447 9.0 62.9 18.4% 0.0% 0.0% 0.0% 34.54sec 43040 299.94sec
Kyrian_Pelagos Kyrian_Pelagos rune_of_power 116011 0 0 0.00 0 0 6.0 0.0 0.0% 0.0% 0.0% 0.0% 51.31sec 0 299.94sec
Kyrian_Pelagos Kyrian_Pelagos time_warp 80353 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 300.56sec 0 299.94sec
Kyrian_Pelagos Kyrian_Pelagos touch_of_the_magi 321507 0 0 0.00 0 0 6.1 0.0 0.0% 0.0% 0.0% 0.0% 52.39sec 0 299.94sec
Kyrian_Pelagos Kyrian_Pelagos touch_of_the_magi_explosion 210833 203396 678 3.67 11100 0 6.1 18.3 0.0% 0.0% 0.0% 0.0% 52.29sec 203396 299.94sec
Kyrian_Pelagos Kyrian_Pelagos use_mana_gem 5405 0 0 0.00 0 0 2.7 0.0 0.0% 0.0% 0.0% 0.0% 124.75sec 0 299.94sec
Necrolord_Emeni Necrolord_Emeni arcane_barrage 44425 745546 2486 31.16 4031 8197 52.0 155.7 18.1% 0.0% 0.0% 0.0% 5.42sec 745546 299.94sec
Necrolord_Emeni Necrolord_Emeni arcane_blast 30451 917195 3058 19.81 7698 15358 34.2 99.0 20.4% 0.0% 0.0% 0.0% 7.17sec 917195 299.94sec
Necrolord_Emeni Necrolord_Emeni arcane_explosion 1449 840675 2803 82.10 1724 3494 136.8 410.4 18.3% 0.0% 0.0% 0.0% 2.02sec 840675 299.94sec
Necrolord_Emeni Necrolord_Emeni arcane_orb 153626 0 0 0.00 0 0 11.6 0.0 0.0% 0.0% 0.0% 0.0% 24.65sec 0 299.94sec
Necrolord_Emeni Necrolord_Emeni arcane_orb_bolt 153640 151566 505 6.94 3666 7550 34.7 34.7 18.1% 0.0% 0.0% 0.0% 24.65sec 151566 299.94sec
Necrolord_Emeni Necrolord_Emeni arcane_power 12042 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 127.07sec 0 299.94sec
Necrolord_Emeni Necrolord_Emeni berserking 26297 0 0 0.00 0 0 1.9 0.0 0.0% 0.0% 0.0% 0.0% 254.36sec 0 299.94sec
Necrolord_Emeni Necrolord_Emeni conjure_mana_gem 759 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
Necrolord_Emeni Necrolord_Emeni deathborne 324220 0 0 0.00 0 0 1.9 0.0 0.0% 0.0% 0.0% 0.0% 253.82sec 0 299.94sec
Necrolord_Emeni Necrolord_Emeni deathly_fixation 322253 0 0 0.00 0 0 17.5 0.0 0.0% 0.0% 0.0% 0.0% 1.42sec 0 299.94sec
Necrolord_Emeni Necrolord_Emeni deathly_eruption 322256 24157 81 3.51 1136 2271 17.5 17.5 21.4% 0.0% 0.0% 0.0% 1.42sec 24157 299.94sec
Necrolord_Emeni Necrolord_Emeni eternal_insight 342314 11603 39 4.20 464 928 21.0 21.0 19.0% 0.0% 0.0% 0.0% 13.71sec 11603 299.94sec
Necrolord_Emeni Necrolord_Emeni evocation 12051 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 184.99sec 0 299.94sec
Necrolord_Emeni Necrolord_Emeni flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
Necrolord_Emeni Necrolord_Emeni food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
Necrolord_Emeni Necrolord_Emeni frostbolt 116 1177 4 0.20 1024 2047 0.0 1.0 15.0% 0.0% 0.0% 0.0% 0.00sec 1177 299.94sec
Necrolord_Emeni Necrolord_Emeni mirror_image 55342 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
Necrolord_Emeni Necrolord_Emeni_mirror_image frostbolt 59638 6439 161 175.50 46 93 117.0 117.0 19.9% 0.0% 0.0% 0.0% 0.99sec 6439 40.00sec
Necrolord_Emeni Necrolord_Emeni potion 307497 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
Necrolord_Emeni Necrolord_Emeni presence_of_mind 205025 0 0 0.00 0 0 1.8 0.0 0.0% 0.0% 0.0% 0.0% 247.87sec 0 299.94sec
Necrolord_Emeni Necrolord_Emeni rune_of_power 116011 0 0 0.00 0 0 6.1 0.0 0.0% 0.0% 0.0% 0.0% 50.55sec 0 299.94sec
Necrolord_Emeni Necrolord_Emeni time_warp 80353 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 300.40sec 0 299.94sec
Necrolord_Emeni Necrolord_Emeni touch_of_the_magi 321507 0 0 0.00 0 0 6.2 0.0 0.0% 0.0% 0.0% 0.0% 51.57sec 0 299.94sec
Necrolord_Emeni Necrolord_Emeni touch_of_the_magi_explosion 210833 241923 807 3.71 13034 0 6.2 18.6 0.0% 0.0% 0.0% 0.0% 51.45sec 241923 299.94sec
Necrolord_Emeni Necrolord_Emeni use_mana_gem 5405 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 121.84sec 0 299.94sec
Necrolord_Marileth Necrolord_Marileth arcane_barrage 44425 732644 2443 31.16 3958 8031 52.0 155.8 18.3% 0.0% 0.0% 0.0% 5.41sec 732644 299.94sec
Necrolord_Marileth Necrolord_Marileth arcane_blast 30451 797053 2657 19.80 6709 13277 34.2 99.0 20.4% 0.0% 0.0% 0.0% 7.12sec 797053 299.94sec
Necrolord_Marileth Necrolord_Marileth arcane_explosion 1449 830118 2768 82.10 1703 3446 136.8 410.4 18.3% 0.0% 0.0% 0.0% 2.02sec 830118 299.94sec
Necrolord_Marileth Necrolord_Marileth arcane_orb 153626 0 0 0.00 0 0 11.6 0.0 0.0% 0.0% 0.0% 0.0% 24.67sec 0 299.94sec
Necrolord_Marileth Necrolord_Marileth arcane_orb_bolt 153640 148389 495 6.95 3593 7350 34.7 34.7 18.1% 0.0% 0.0% 0.0% 24.67sec 148389 299.94sec
Necrolord_Marileth Necrolord_Marileth arcane_power 12042 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 126.96sec 0 299.94sec
Necrolord_Marileth Necrolord_Marileth berserking 26297 0 0 0.00 0 0 1.9 0.0 0.0% 0.0% 0.0% 0.0% 254.15sec 0 299.94sec
Necrolord_Marileth Necrolord_Marileth conjure_mana_gem 759 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
Necrolord_Marileth Necrolord_Marileth deathborne 324220 0 0 0.00 0 0 1.9 0.0 0.0% 0.0% 0.0% 0.0% 253.65sec 0 299.94sec
Necrolord_Marileth Necrolord_Marileth deathly_fixation 322253 0 0 0.00 0 0 17.5 0.0 0.0% 0.0% 0.0% 0.0% 1.42sec 0 299.94sec
Necrolord_Marileth Necrolord_Marileth deathly_eruption 322256 24197 81 3.51 1137 2276 17.5 17.5 21.3% 0.0% 0.0% 0.0% 1.42sec 24197 299.94sec
Necrolord_Marileth Necrolord_Marileth eternal_insight 342314 11833 39 4.28 464 929 21.4 21.4 19.2% 0.0% 0.0% 0.0% 13.84sec 11833 299.94sec
Necrolord_Marileth Necrolord_Marileth evocation 12051 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 184.99sec 0 299.94sec
Necrolord_Marileth Necrolord_Marileth flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
Necrolord_Marileth Necrolord_Marileth food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
Necrolord_Marileth Necrolord_Marileth frostbolt 116 1212 4 0.20 1024 2047 0.0 1.0 18.3% 0.0% 0.0% 0.0% 0.00sec 1212 299.94sec
Necrolord_Marileth Necrolord_Marileth mirror_image 55342 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
Necrolord_Marileth Necrolord_Marileth_mirror_image frostbolt 59638 5712 143 175.50 41 82 117.0 117.0 19.9% 0.0% 0.0% 0.0% 0.99sec 5712 40.00sec
Necrolord_Marileth Necrolord_Marileth potion 307497 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
Necrolord_Marileth Necrolord_Marileth presence_of_mind 205025 0 0 0.00 0 0 1.8 0.0 0.0% 0.0% 0.0% 0.0% 244.29sec 0 299.94sec
Necrolord_Marileth Necrolord_Marileth rune_of_power 116011 0 0 0.00 0 0 6.1 0.0 0.0% 0.0% 0.0% 0.0% 50.53sec 0 299.94sec
Necrolord_Marileth Necrolord_Marileth time_warp 80353 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 300.40sec 0 299.94sec
Necrolord_Marileth Necrolord_Marileth touch_of_the_magi 321507 0 0 0.00 0 0 6.2 0.0 0.0% 0.0% 0.0% 0.0% 51.52sec 0 299.94sec
Necrolord_Marileth Necrolord_Marileth touch_of_the_magi_explosion 210833 218257 728 3.71 11762 0 6.2 18.6 0.0% 0.0% 0.0% 0.0% 51.44sec 218257 299.94sec
Necrolord_Marileth Necrolord_Marileth use_mana_gem 5405 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 121.18sec 0 299.94sec
NightFae_Dream NightFae_Dream arcane_barrage 44425 996283 3322 35.17 4763 9617 58.7 175.8 18.6% 0.0% 0.0% 0.0% 5.12sec 996283 299.94sec
NightFae_Dream NightFae_Dream arcane_explosion 1449 1140570 3803 93.33 2058 4142 155.5 466.6 18.5% 0.0% 0.0% 0.0% 1.91sec 1140570 299.94sec
NightFae_Dream NightFae_Dream arcane_orb 153626 0 0 0.00 0 0 14.2 0.0 0.0% 0.0% 0.0% 0.0% 21.66sec 0 299.94sec
NightFae_Dream NightFae_Dream arcane_orb_bolt 153640 216851 723 8.52 4291 8592 42.6 42.6 18.6% 0.0% 0.0% 0.0% 21.66sec 216851 299.94sec
NightFae_Dream NightFae_Dream arcane_power 12042 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 97.60sec 0 299.94sec
NightFae_Dream NightFae_Dream berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 194.93sec 0 299.94sec
NightFae_Dream NightFae_Dream conjure_mana_gem 759 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
NightFae_Dream NightFae_Dream deathly_fixation 322253 0 0 0.00 0 0 22.8 0.0 0.0% 0.0% 0.0% 0.0% 7.44sec 0 299.94sec
NightFae_Dream NightFae_Dream deathly_eruption 322256 31219 104 4.56 1138 2279 22.8 22.8 20.4% 0.0% 0.0% 0.0% 7.44sec 31219 299.94sec
NightFae_Dream NightFae_Dream eternal_insight 342314 12035 40 4.36 464 928 21.8 21.8 18.8% 0.0% 0.0% 0.0% 13.22sec 12035 299.94sec
NightFae_Dream NightFae_Dream evocation 12051 0 0 0.00 0 0 0.4 0.0 0.0% 0.0% 0.0% 0.0% 186.14sec 0 299.94sec
NightFae_Dream NightFae_Dream flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
NightFae_Dream NightFae_Dream food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
NightFae_Dream NightFae_Dream frostbolt 116 1178 4 0.20 1024 2047 0.0 1.0 15.1% 0.0% 0.0% 0.0% 0.00sec 1178 299.94sec
NightFae_Dream NightFae_Dream mirror_image 55342 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
NightFae_Dream NightFae_Dream_mirror_image frostbolt 59638 5699 142 175.50 41 82 117.0 117.0 19.9% 0.0% 0.0% 0.0% 0.99sec 5699 40.00sec
NightFae_Dream NightFae_Dream potion 307497 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 300.59sec 0 299.94sec
NightFae_Dream NightFae_Dream rune_of_power 116011 0 0 0.00 0 0 6.9 0.0 0.0% 0.0% 0.0% 0.0% 43.91sec 0 299.94sec
NightFae_Dream NightFae_Dream shifting_power ticks -314791 83330 278 4.85 958 1915 6.1 24.3 19.5% 0.0% 0.0% 0.0% 48.01sec 83330 299.94sec
NightFae_Dream NightFae_Dream time_warp 80353 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 240.36sec 0 299.94sec
NightFae_Dream NightFae_Dream touch_of_the_magi 321507 0 0 0.00 0 0 7.0 0.0 0.0% 0.0% 0.0% 0.0% 45.77sec 0 299.94sec
NightFae_Dream NightFae_Dream touch_of_the_magi_explosion 210833 201920 673 4.20 9627 0 7.0 21.0 0.0% 0.0% 0.0% 0.0% 45.64sec 201920 299.94sec
NightFae_Dream NightFae_Dream use_mana_gem 5405 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 121.37sec 0 299.94sec
NightFae_Dream_SB NightFae_Dream_SB arcane_barrage 44425 1009255 3365 35.18 4833 9742 58.7 175.8 18.5% 0.0% 0.0% 0.0% 5.12sec 1009255 299.94sec
NightFae_Dream_SB NightFae_Dream_SB arcane_explosion 1449 1158489 3862 93.39 2086 4197 155.6 466.9 18.7% 0.0% 0.0% 0.0% 1.91sec 1158489 299.94sec
NightFae_Dream_SB NightFae_Dream_SB arcane_orb 153626 0 0 0.00 0 0 14.2 0.0 0.0% 0.0% 0.0% 0.0% 21.65sec 0 299.94sec
NightFae_Dream_SB NightFae_Dream_SB arcane_orb_bolt 153640 220145 734 8.52 4346 8757 42.6 42.6 18.7% 0.0% 0.0% 0.0% 21.64sec 220145 299.94sec
NightFae_Dream_SB NightFae_Dream_SB arcane_power 12042 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 97.65sec 0 299.94sec
NightFae_Dream_SB NightFae_Dream_SB berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 194.97sec 0 299.94sec
NightFae_Dream_SB NightFae_Dream_SB conjure_mana_gem 759 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
NightFae_Dream_SB NightFae_Dream_SB deathly_fixation 322253 0 0 0.00 0 0 22.7 0.0 0.0% 0.0% 0.0% 0.0% 7.43sec 0 299.94sec
NightFae_Dream_SB NightFae_Dream_SB deathly_eruption 322256 31735 106 4.54 1156 2314 22.7 22.7 20.8% 0.0% 0.0% 0.0% 7.43sec 31735 299.94sec
NightFae_Dream_SB NightFae_Dream_SB eternal_insight 342314 12315 41 4.41 471 941 22.0 22.0 18.8% 0.0% 0.0% 0.0% 13.71sec 12315 299.94sec
NightFae_Dream_SB NightFae_Dream_SB evocation 12051 0 0 0.00 0 0 0.4 0.0 0.0% 0.0% 0.0% 0.0% 194.77sec 0 299.94sec
NightFae_Dream_SB NightFae_Dream_SB flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
NightFae_Dream_SB NightFae_Dream_SB food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
NightFae_Dream_SB NightFae_Dream_SB frostbolt 116 1203 4 0.20 1052 2104 0.0 1.0 14.3% 0.0% 0.0% 0.0% 0.00sec 1203 299.94sec
NightFae_Dream_SB NightFae_Dream_SB mirror_image 55342 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
NightFae_Dream_SB NightFae_Dream_SB_mirror_image frostbolt 59638 5776 144 175.50 41 83 117.0 117.0 19.9% 0.0% 0.0% 0.0% 0.99sec 5776 40.00sec
NightFae_Dream_SB NightFae_Dream_SB potion 307497 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 300.63sec 0 299.94sec
NightFae_Dream_SB NightFae_Dream_SB rune_of_power 116011 0 0 0.00 0 0 6.9 0.0 0.0% 0.0% 0.0% 0.0% 43.83sec 0 299.94sec
NightFae_Dream_SB NightFae_Dream_SB shifting_power ticks -314791 84156 281 4.85 969 1937 6.1 24.3 19.4% 0.0% 0.0% 0.0% 48.04sec 84156 299.94sec
NightFae_Dream_SB NightFae_Dream_SB time_warp 80353 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 240.35sec 0 299.94sec
NightFae_Dream_SB NightFae_Dream_SB touch_of_the_magi 321507 0 0 0.00 0 0 7.0 0.0 0.0% 0.0% 0.0% 0.0% 45.56sec 0 299.94sec
NightFae_Dream_SB NightFae_Dream_SB touch_of_the_magi_explosion 210833 206263 688 4.19 9851 0 7.0 20.9 0.0% 0.0% 0.0% 0.0% 45.43sec 206263 299.94sec
NightFae_Dream_SB NightFae_Dream_SB use_mana_gem 5405 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 120.95sec 0 299.94sec
NightFae_Koraylon NightFae_Koraylon arcane_barrage 44425 1028033 3427 35.17 4919 9923 58.7 175.8 18.6% 0.0% 0.0% 0.0% 5.12sec 1028033 299.94sec
NightFae_Koraylon NightFae_Koraylon arcane_explosion 1449 1180980 3937 93.38 2126 4292 155.6 466.8 18.6% 0.0% 0.0% 0.0% 1.91sec 1180980 299.94sec
NightFae_Koraylon NightFae_Koraylon arcane_orb 153626 0 0 0.00 0 0 14.2 0.0 0.0% 0.0% 0.0% 0.0% 21.66sec 0 299.94sec
NightFae_Koraylon NightFae_Koraylon arcane_orb_bolt 153640 223620 746 8.51 4424 8829 42.5 42.5 18.9% 0.0% 0.0% 0.0% 21.65sec 223620 299.94sec
NightFae_Koraylon NightFae_Koraylon arcane_power 12042 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 97.60sec 0 299.94sec
NightFae_Koraylon NightFae_Koraylon berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 194.96sec 0 299.94sec
NightFae_Koraylon NightFae_Koraylon conjure_mana_gem 759 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
NightFae_Koraylon NightFae_Koraylon deathly_fixation 322253 0 0 0.00 0 0 22.8 0.0 0.0% 0.0% 0.0% 0.0% 7.47sec 0 299.94sec
NightFae_Koraylon NightFae_Koraylon deathly_eruption 322256 33777 113 4.55 1231 2464 22.8 22.8 20.6% 0.0% 0.0% 0.0% 7.47sec 33777 299.94sec
NightFae_Koraylon NightFae_Koraylon eternal_insight 342314 12384 41 4.36 478 957 21.8 21.8 18.9% 0.0% 0.0% 0.0% 13.56sec 12384 299.94sec
NightFae_Koraylon NightFae_Koraylon evocation 12051 0 0 0.00 0 0 0.4 0.0 0.0% 0.0% 0.0% 0.0% 197.21sec 0 299.94sec
NightFae_Koraylon NightFae_Koraylon flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
NightFae_Koraylon NightFae_Koraylon food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
NightFae_Koraylon NightFae_Koraylon frostbolt 116 1292 4 0.20 1126 2252 0.0 1.0 14.7% 0.0% 0.0% 0.0% 0.00sec 1292 299.94sec
NightFae_Koraylon NightFae_Koraylon mirror_image 55342 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
NightFae_Koraylon NightFae_Koraylon_mirror_image frostbolt 59638 5691 142 175.50 41 82 117.0 117.0 19.8% 0.0% 0.0% 0.0% 0.99sec 5691 40.00sec
NightFae_Koraylon NightFae_Koraylon potion 307497 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 300.50sec 0 299.94sec
NightFae_Koraylon NightFae_Koraylon rune_of_power 116011 0 0 0.00 0 0 6.9 0.0 0.0% 0.0% 0.0% 0.0% 44.01sec 0 299.94sec
NightFae_Koraylon NightFae_Koraylon shifting_power ticks -314791 85448 285 4.86 980 1972 6.1 24.3 19.4% 0.0% 0.0% 0.0% 47.99sec 85448 299.94sec
NightFae_Koraylon NightFae_Koraylon time_warp 80353 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 240.34sec 0 299.94sec
NightFae_Koraylon NightFae_Koraylon touch_of_the_magi 321507 0 0 0.00 0 0 7.0 0.0 0.0% 0.0% 0.0% 0.0% 45.77sec 0 299.94sec
NightFae_Koraylon NightFae_Koraylon touch_of_the_magi_explosion 210833 210207 701 4.19 10037 0 7.0 21.0 0.0% 0.0% 0.0% 0.0% 45.63sec 210207 299.94sec
NightFae_Koraylon NightFae_Koraylon use_mana_gem 5405 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 121.42sec 0 299.94sec
NightFae_Niya NightFae_Niya arcane_barrage 44425 1011022 3371 35.30 4821 9731 58.9 176.5 18.5% 0.0% 0.0% 0.0% 5.11sec 1011022 299.94sec
NightFae_Niya NightFae_Niya arcane_explosion 1449 1168723 3896 93.80 2095 4226 156.3 468.9 18.6% 0.0% 0.0% 0.0% 1.90sec 1168723 299.94sec
NightFae_Niya NightFae_Niya arcane_orb 153626 0 0 0.00 0 0 14.2 0.0 0.0% 0.0% 0.0% 0.0% 21.66sec 0 299.94sec
NightFae_Niya NightFae_Niya arcane_orb_bolt 153640 221251 738 8.51 4386 8744 42.5 42.5 18.7% 0.0% 0.0% 0.0% 21.66sec 221251 299.94sec
NightFae_Niya NightFae_Niya arcane_power 12042 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 97.58sec 0 299.94sec
NightFae_Niya NightFae_Niya berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 194.88sec 0 299.94sec
NightFae_Niya NightFae_Niya conjure_mana_gem 759 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
NightFae_Niya NightFae_Niya deathly_fixation 322253 0 0 0.00 0 0 22.8 0.0 0.0% 0.0% 0.0% 0.0% 7.47sec 0 299.94sec
NightFae_Niya NightFae_Niya deathly_eruption 322256 31255 104 4.55 1138 2277 22.8 22.8 20.6% 0.0% 0.0% 0.0% 7.47sec 31255 299.94sec
NightFae_Niya NightFae_Niya eternal_insight 342314 11951 40 4.34 464 929 21.7 21.7 18.6% 0.0% 0.0% 0.0% 13.39sec 11951 299.94sec
NightFae_Niya NightFae_Niya evocation 12051 0 0 0.00 0 0 0.1 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
NightFae_Niya NightFae_Niya flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
NightFae_Niya NightFae_Niya food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
NightFae_Niya NightFae_Niya frostbolt 116 1175 4 0.20 1024 2047 0.0 1.0 14.8% 0.0% 0.0% 0.0% 0.00sec 1175 299.94sec
NightFae_Niya NightFae_Niya mirror_image 55342 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
NightFae_Niya NightFae_Niya_mirror_image frostbolt 59638 5697 142 175.50 41 82 117.0 117.0 19.9% 0.0% 0.0% 0.0% 0.99sec 5697 40.00sec
NightFae_Niya NightFae_Niya potion 307497 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 300.54sec 0 299.94sec
NightFae_Niya NightFae_Niya rune_of_power 116011 0 0 0.00 0 0 6.9 0.0 0.0% 0.0% 0.0% 0.0% 43.99sec 0 299.94sec
NightFae_Niya NightFae_Niya shifting_power ticks -314791 83357 278 4.85 957 1915 6.1 24.3 19.6% 0.0% 0.0% 0.0% 47.89sec 83357 299.94sec
NightFae_Niya NightFae_Niya time_warp 80353 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 240.34sec 0 299.94sec
NightFae_Niya NightFae_Niya touch_of_the_magi 321507 0 0 0.00 0 0 7.0 0.0 0.0% 0.0% 0.0% 0.0% 45.72sec 0 299.94sec
NightFae_Niya NightFae_Niya touch_of_the_magi_explosion 210833 205916 687 4.20 9806 0 7.0 21.0 0.0% 0.0% 0.0% 0.0% 45.56sec 205916 299.94sec
NightFae_Niya NightFae_Niya use_mana_gem 5405 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 120.90sec 0 299.94sec
Venthyr_Nadjia Venthyr_Nadjia arcane_barrage 44425 976340 3255 36.44 4472 9182 60.8 182.2 18.9% 0.0% 0.0% 0.0% 4.94sec 976340 299.94sec
Venthyr_Nadjia Venthyr_Nadjia arcane_explosion 1449 1164112 3881 101.32 1923 3944 168.8 506.5 18.6% 0.0% 0.0% 0.0% 1.75sec 1164112 299.94sec
Venthyr_Nadjia Venthyr_Nadjia arcane_orb 153626 0 0 0.00 0 0 13.4 0.0 0.0% 0.0% 0.0% 0.0% 23.00sec 0 299.94sec
Venthyr_Nadjia Venthyr_Nadjia arcane_orb_bolt 153640 198309 661 8.03 4141 8514 40.1 40.1 18.3% 0.0% 0.0% 0.0% 23.00sec 198309 299.94sec
Venthyr_Nadjia Venthyr_Nadjia arcane_power 12042 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 125.77sec 0 299.94sec
Venthyr_Nadjia Venthyr_Nadjia berserking 26297 0 0 0.00 0 0 1.9 0.0 0.0% 0.0% 0.0% 0.0% 251.42sec 0 299.94sec
Venthyr_Nadjia Venthyr_Nadjia conjure_mana_gem 759 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
Venthyr_Nadjia Venthyr_Nadjia deathly_fixation 322253 0 0 0.00 0 0 18.6 0.0 0.0% 0.0% 0.0% 0.0% 1.33sec 0 299.94sec
Venthyr_Nadjia Venthyr_Nadjia deathly_eruption 322256 25598 85 3.73 1136 2274 18.6 18.6 20.9% 0.0% 0.0% 0.0% 1.33sec 25598 299.94sec
Venthyr_Nadjia Venthyr_Nadjia eternal_insight 342314 12055 40 4.39 464 929 21.9 21.9 18.4% 0.0% 0.0% 0.0% 13.42sec 12055 299.94sec
Venthyr_Nadjia Venthyr_Nadjia evocation 12051 0 0 0.00 0 0 1.1 0.0 0.0% 0.0% 0.0% 0.0% 225.57sec 0 299.94sec
Venthyr_Nadjia Venthyr_Nadjia flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
Venthyr_Nadjia Venthyr_Nadjia food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
Venthyr_Nadjia Venthyr_Nadjia frostbolt 116 1194 4 0.20 1024 2047 0.0 1.0 16.7% 0.0% 0.0% 0.0% 0.00sec 1194 299.94sec
Venthyr_Nadjia Venthyr_Nadjia mirror_image 55342 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
Venthyr_Nadjia Venthyr_Nadjia_mirror_image frostbolt 59638 5756 144 175.50 41 83 117.0 117.0 20.0% 0.0% 0.0% 0.0% 0.99sec 5756 40.00sec
Venthyr_Nadjia Venthyr_Nadjia mirrors_of_torment 314793 0 0 0.00 0 0 2.4 0.0 0.0% 0.0% 0.0% 0.0% 152.85sec 0 299.94sec
Venthyr_Nadjia Venthyr_Nadjia agonizing_backlash 320035 12427 41 0.95 2185 4530 4.8 4.8 18.1% 0.0% 0.0% 0.0% 58.37sec 12427 299.94sec
Venthyr_Nadjia Venthyr_Nadjia tormenting_backlash 317589 13381 45 0.46 4809 9867 2.3 2.3 19.6% 0.0% 0.0% 0.0% 152.98sec 13381 299.94sec
Venthyr_Nadjia Venthyr_Nadjia potion 307497 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
Venthyr_Nadjia Venthyr_Nadjia rune_of_power 116011 0 0 0.00 0 0 6.1 0.0 0.0% 0.0% 0.0% 0.0% 50.06sec 0 299.94sec
Venthyr_Nadjia Venthyr_Nadjia time_warp 80353 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 300.66sec 0 299.94sec
Venthyr_Nadjia Venthyr_Nadjia touch_of_the_magi 321507 0 0 0.00 0 0 6.2 0.0 0.0% 0.0% 0.0% 0.0% 51.16sec 0 299.94sec
Venthyr_Nadjia Venthyr_Nadjia touch_of_the_magi_explosion 210833 192699 642 3.74 10305 0 6.2 18.7 0.0% 0.0% 0.0% 0.0% 51.05sec 192699 299.94sec
Venthyr_Nadjia Venthyr_Nadjia use_mana_gem 5405 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 124.48sec 0 299.94sec
Venthyr_Theotar Venthyr_Theotar arcane_barrage 44425 970714 3236 36.05 4517 9176 60.2 180.2 18.7% 0.0% 0.0% 0.0% 4.99sec 970714 299.94sec
Venthyr_Theotar Venthyr_Theotar arcane_explosion 1449 1161374 3872 99.26 1956 4018 165.4 496.2 18.7% 0.0% 0.0% 0.0% 1.79sec 1161374 299.94sec
Venthyr_Theotar Venthyr_Theotar arcane_orb 153626 0 0 0.00 0 0 13.3 0.0 0.0% 0.0% 0.0% 0.0% 23.20sec 0 299.94sec
Venthyr_Theotar Venthyr_Theotar arcane_orb_bolt 153640 199698 666 7.98 4189 8646 39.9 39.9 18.3% 0.0% 0.0% 0.0% 23.20sec 199698 299.94sec
Venthyr_Theotar Venthyr_Theotar arcane_power 12042 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 128.59sec 0 299.94sec
Venthyr_Theotar Venthyr_Theotar berserking 26297 0 0 0.00 0 0 1.8 0.0 0.0% 0.0% 0.0% 0.0% 257.25sec 0 299.94sec
Venthyr_Theotar Venthyr_Theotar conjure_mana_gem 759 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
Venthyr_Theotar Venthyr_Theotar deathly_fixation 322253 0 0 0.00 0 0 18.6 0.0 0.0% 0.0% 0.0% 0.0% 1.36sec 0 299.94sec
Venthyr_Theotar Venthyr_Theotar deathly_eruption 322256 25566 85 3.72 1138 2278 18.6 18.6 20.8% 0.0% 0.0% 0.0% 1.36sec 25566 299.94sec
Venthyr_Theotar Venthyr_Theotar eternal_insight 342314 11844 39 4.30 464 928 21.5 21.5 18.7% 0.0% 0.0% 0.0% 13.67sec 11844 299.94sec
Venthyr_Theotar Venthyr_Theotar evocation 12051 0 0 0.00 0 0 0.8 0.0 0.0% 0.0% 0.0% 0.0% 262.76sec 0 299.94sec
Venthyr_Theotar Venthyr_Theotar flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
Venthyr_Theotar Venthyr_Theotar food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
Venthyr_Theotar Venthyr_Theotar frostbolt 116 1196 4 0.20 1024 2047 0.0 1.0 16.8% 0.0% 0.0% 0.0% 0.00sec 1196 299.94sec
Venthyr_Theotar Venthyr_Theotar mirror_image 55342 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
Venthyr_Theotar Venthyr_Theotar_mirror_image frostbolt 59638 5754 144 175.50 41 83 117.0 117.0 19.9% 0.0% 0.0% 0.0% 0.99sec 5754 40.00sec
Venthyr_Theotar Venthyr_Theotar mirrors_of_torment 314793 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 131.32sec 0 299.94sec
Venthyr_Theotar Venthyr_Theotar agonizing_backlash 320035 16871 56 1.13 2508 5090 5.6 5.6 18.9% 0.0% 0.0% 0.0% 53.17sec 16871 299.94sec
Venthyr_Theotar Venthyr_Theotar tormenting_backlash 317589 16627 55 0.55 5025 10276 2.7 2.7 19.5% 0.0% 0.0% 0.0% 132.92sec 16627 299.94sec
Venthyr_Theotar Venthyr_Theotar potion 307497 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
Venthyr_Theotar Venthyr_Theotar rune_of_power 116011 0 0 0.00 0 0 6.0 0.0 0.0% 0.0% 0.0% 0.0% 51.03sec 0 299.94sec
Venthyr_Theotar Venthyr_Theotar time_warp 80353 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 300.21sec 0 299.94sec
Venthyr_Theotar Venthyr_Theotar touch_of_the_magi 321507 0 0 0.00 0 0 6.1 0.0 0.0% 0.0% 0.0% 0.0% 52.15sec 0 299.94sec
Venthyr_Theotar Venthyr_Theotar touch_of_the_magi_explosion 210833 194040 647 3.68 10554 0 6.1 18.4 0.0% 0.0% 0.0% 0.0% 52.08sec 194040 299.94sec
Venthyr_Theotar Venthyr_Theotar use_mana_gem 5405 0 0 0.00 0 0 2.7 0.0 0.0% 0.0% 0.0% 0.0% 125.79sec 0 299.94sec
arcane arcane arcane_barrage 44425 964872 3217 36.17 4464 9126 60.4 180.8 18.7% 0.0% 0.0% 0.0% 4.98sec 964872 299.94sec
arcane arcane arcane_explosion 1449 1151506 3839 100.06 1927 3943 166.7 500.2 18.6% 0.0% 0.0% 0.0% 1.78sec 1151506 299.94sec
arcane arcane arcane_orb 153626 0 0 0.00 0 0 13.3 0.0 0.0% 0.0% 0.0% 0.0% 23.35sec 0 299.94sec
arcane arcane arcane_orb_bolt 153640 194401 648 7.95 4100 8434 39.7 39.7 18.3% 0.0% 0.0% 0.0% 23.36sec 194401 299.94sec
arcane arcane arcane_power 12042 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 127.00sec 0 299.94sec
arcane arcane berserking 26297 0 0 0.00 0 0 1.9 0.0 0.0% 0.0% 0.0% 0.0% 254.01sec 0 299.94sec
arcane arcane conjure_mana_gem 759 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
arcane arcane deathly_fixation 322253 0 0 0.00 0 0 18.5 0.0 0.0% 0.0% 0.0% 0.0% 1.35sec 0 299.94sec
arcane arcane deathly_eruption 322256 25292 84 3.70 1136 2275 18.5 18.5 20.3% 0.0% 0.0% 0.0% 1.35sec 25292 299.94sec
arcane arcane eternal_insight 342314 11700 39 4.25 464 929 21.3 21.3 18.5% 0.0% 0.0% 0.0% 13.54sec 11700 299.94sec
arcane arcane evocation 12051 0 0 0.00 0 0 1.2 0.0 0.0% 0.0% 0.0% 0.0% 222.07sec 0 299.94sec
arcane arcane flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
arcane arcane food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
arcane arcane frostbolt 116 1173 4 0.20 1024 2047 0.0 1.0 14.6% 0.0% 0.0% 0.0% 0.00sec 1173 299.94sec
arcane arcane mirror_image 55342 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
arcane arcane_mirror_image frostbolt 59638 5702 143 175.50 41 82 117.0 117.0 20.0% 0.0% 0.0% 0.0% 0.99sec 5702 40.00sec
arcane arcane potion 307497 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
arcane arcane rune_of_power 116011 0 0 0.00 0 0 6.1 0.0 0.0% 0.0% 0.0% 0.0% 50.43sec 0 299.94sec
arcane arcane time_warp 80353 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 300.08sec 0 299.94sec
arcane arcane touch_of_the_magi 321507 0 0 0.00 0 0 6.2 0.0 0.0% 0.0% 0.0% 0.0% 51.52sec 0 299.94sec
arcane arcane touch_of_the_magi_explosion 210833 127745 426 3.73 6858 0 6.2 18.6 0.0% 0.0% 0.0% 0.0% 51.42sec 127745 299.94sec
arcane arcane use_mana_gem 5405 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 124.19sec 0 299.94sec

Fluffy_Pillow : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
39417.1 0.0 Health 0.00% 0.0 100.0% 100%
Talents
  • 15: None
  • 25: None
  • 30: None
  • 35: None
  • 40: None
  • 45: None
  • 50: None
  • Talent Calculator

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 0.7 0.0 0.0sec 0.0sec 55.6sec 12.59% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 151.7s

Stack Uptimes

  • Health Decade (0 - 10)_1:12.63%
Health Decade (10 - 20) 0.9 0.0 0.0sec 0.0sec 28.8sec 8.50% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 47.1s

Stack Uptimes

  • Health Decade (10 - 20)_1:8.51%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 33.8sec 11.22% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:1.0s / 45.6s

Stack Uptimes

  • Health Decade (20 - 30)_1:11.22%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 37.4sec 12.63% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:20.5s / 50.5s

Stack Uptimes

  • Health Decade (30 - 40)_1:12.63%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 35.7sec 12.06% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:23.3s / 52.1s

Stack Uptimes

  • Health Decade (40 - 50)_1:12.06%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 35.3sec 11.91% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:28.8s / 43.4s

Stack Uptimes

  • Health Decade (50 - 60)_1:11.91%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 41.0sec 13.86% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:29.8s / 50.3s

Stack Uptimes

  • Health Decade (60 - 70)_1:13.86%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 30.4sec 10.27% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:12.1s / 50.9s

Stack Uptimes

  • Health Decade (70 - 80)_1:10.27%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 11.1sec 3.76% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:4.6s / 21.3s

Stack Uptimes

  • Health Decade (80 - 90)_1:3.76%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 12.9sec 3.18% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:7.8s / 300.0s

Stack Uptimes

  • Health Decade (90 - 100)_1:3.18%
Mirrors of Torment 2.8 0.0 130.1sec 130.9sec 13.3sec 12.61% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_mirrors_of_torment
  • max_stacks:3
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:refresh
  • tick_time behavior:unhasted
  • period:1.50

Trigger Details

  • interval_min/max:1.3s / 163.4s
  • trigger_min/max:96.6s / 163.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 13.5s

Stack Uptimes

  • mirrors_of_torment_1:5.54%
  • mirrors_of_torment_2:5.65%
  • mirrors_of_torment_3:1.43%

Spelldata

  • id:314793
  • name:Mirrors of Torment
  • tooltip:Attacking, casting a spell or ability, consumes a mirror to inflict Shadow damage and reduce cast and movement speed by $320035s3%. Your final mirror will instead Root and Silence you for {$317589d=4 seconds}.
  • description:Conjure $n mirrors to torment the enemy for {$d=25 seconds}. Whenever the target attacks, casts a spell, or uses an ability, a mirror is consumed to inflict $320035s1 Shadow damage and their movement and cast speed are slowed by $320035s3%. This effect cannot be triggered more often than once per {$345977d=6 seconds}. The final mirror will instead inflict $317589s1 Shadow damage to the enemy, Rooting and Silencing them for {$317589d=4 seconds}. Whenever a mirror is consumed $?c1[you gain $345417s1% mana][]$?c2[your Fire Blast cooldown is reduced by $s2 sec][]$?c3[you gain Brain Freeze][].
  • max_stacks:0
  • duration:25.00
  • cooldown:90.00
  • default_chance:100.00%
Mirrors of Torment 2.4 0.0 152.0sec 153.2sec 13.2sec 10.60% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_mirrors_of_torment
  • max_stacks:3
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:refresh
  • tick_time behavior:unhasted
  • period:1.50

Trigger Details

  • interval_min/max:1.3s / 162.8s
  • trigger_min/max:94.2s / 162.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 13.5s

Stack Uptimes

  • mirrors_of_torment_1:4.65%
  • mirrors_of_torment_2:4.75%
  • mirrors_of_torment_3:1.20%

Spelldata

  • id:314793
  • name:Mirrors of Torment
  • tooltip:Attacking, casting a spell or ability, consumes a mirror to inflict Shadow damage and reduce cast and movement speed by $320035s3%. Your final mirror will instead Root and Silence you for {$317589d=4 seconds}.
  • description:Conjure $n mirrors to torment the enemy for {$d=25 seconds}. Whenever the target attacks, casts a spell, or uses an ability, a mirror is consumed to inflict $320035s1 Shadow damage and their movement and cast speed are slowed by $320035s3%. This effect cannot be triggered more often than once per {$345977d=6 seconds}. The final mirror will instead inflict $317589s1 Shadow damage to the enemy, Rooting and Silencing them for {$317589d=4 seconds}. Whenever a mirror is consumed $?c1[you gain $345417s1% mana][]$?c2[your Fire Blast cooldown is reduced by $s2 sec][]$?c3[you gain Brain Freeze][].
  • max_stacks:0
  • duration:25.00
  • cooldown:90.00
  • default_chance:100.00%
Radiant Spark Vulnerability 9.0 26.8 34.4sec 8.0sec 4.5sec 13.69% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_radiant_spark_vulnerability
  • max_stacks:4
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.5s / 58.0s
  • trigger_min/max:0.3s / 52.3s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 8.0s

Stack Uptimes

  • radiant_spark_vulnerability_1:3.50%
  • radiant_spark_vulnerability_2:3.41%
  • radiant_spark_vulnerability_3:3.47%
  • radiant_spark_vulnerability_4:3.30%

Spelldata

  • id:307454
  • name:Radiant Spark Vulnerability
  • tooltip:Damage taken from $@auracaster increased by $w1%.
  • description:{$@spelldesc307443=Conjure a radiant spark that causes $s1 Arcane damage instantly, and an additional $o2 damage over {$d=10 seconds}. The target takes $307454s1% increased damage from your direct damage spells, stacking each time they are struck. This effect ends after {$307454u=4} spells. }
  • max_stacks:4
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Radiant Spark Vulnerability 9.1 26.9 34.3sec 8.0sec 4.5sec 13.72% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Kyrian_Forgelite
  • cooldown name:buff_radiant_spark_vulnerability
  • max_stacks:4
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.5s / 57.8s
  • trigger_min/max:0.3s / 52.3s
  • trigger_pct:99.99%
  • duration_min/max:0.1s / 8.0s

Stack Uptimes

  • radiant_spark_vulnerability_1:3.50%
  • radiant_spark_vulnerability_2:3.42%
  • radiant_spark_vulnerability_3:3.49%
  • radiant_spark_vulnerability_4:3.31%

Spelldata

  • id:307454
  • name:Radiant Spark Vulnerability
  • tooltip:Damage taken from $@auracaster increased by $w1%.
  • description:{$@spelldesc307443=Conjure a radiant spark that causes $s1 Arcane damage instantly, and an additional $o2 damage over {$d=10 seconds}. The target takes $307454s1% increased damage from your direct damage spells, stacking each time they are struck. This effect ends after {$307454u=4} spells. }
  • max_stacks:4
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Sinful Revelation 1.2 0.0 97.2sec 93.1sec 10.0sec 4.00% 0.00% 0.0 (0.0) 1.2

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.6s / 321.3s
  • trigger_min/max:1.7s / 321.3s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 19.9s

Stack Uptimes

  • sinful_revelation_1:4.00%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 1.6 0.0 86.1sec 82.0sec 10.0sec 5.44% 0.00% 0.0 (0.0) 1.6

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.1s / 294.4s
  • trigger_min/max:1.3s / 294.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 19.6s

Stack Uptimes

  • sinful_revelation_1:5.44%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 1.6 0.0 86.9sec 82.7sec 10.0sec 5.46% 0.00% 0.0 (0.0) 1.6

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.1s / 322.7s
  • trigger_min/max:1.3s / 322.7s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 19.6s

Stack Uptimes

  • sinful_revelation_1:5.46%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 1.7 0.0 84.2sec 80.5sec 10.0sec 5.74% 0.00% 0.0 (0.0) 1.7

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.1s / 322.3s
  • trigger_min/max:1.3s / 322.3s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 19.6s

Stack Uptimes

  • sinful_revelation_1:5.74%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 1.6 0.0 84.2sec 79.9sec 10.0sec 5.44% 0.00% 0.0 (0.0) 1.6

Buff Details

  • buff initial source:NightFae_Koraylon
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.1s / 310.7s
  • trigger_min/max:1.8s / 310.7s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 20.7s

Stack Uptimes

  • sinful_revelation_1:5.44%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 1.3 0.0 93.7sec 87.4sec 10.0sec 4.35% 0.00% 0.0 (0.0) 1.3

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.5s / 324.1s
  • trigger_min/max:0.8s / 324.1s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 19.6s

Stack Uptimes

  • sinful_revelation_1:4.36%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 1.2 0.0 95.9sec 89.8sec 9.9sec 4.10% 0.00% 0.0 (0.0) 1.2

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.1s / 312.5s
  • trigger_min/max:0.8s / 312.5s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 19.6s

Stack Uptimes

  • sinful_revelation_1:4.11%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 2.1 0.1 79.1sec 75.6sec 9.9sec 6.89% 0.00% 0.1 (0.1) 2.0

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 305.9s
  • trigger_min/max:0.5s / 305.9s
  • trigger_pct:100.00%
  • duration_min/max:0.4s / 19.9s

Stack Uptimes

  • sinful_revelation_1:6.89%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 2.1 0.1 76.4sec 73.1sec 9.9sec 7.07% 0.00% 0.1 (0.1) 2.1

Buff Details

  • buff initial source:Kyrian_Forgelite
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.1s / 346.1s
  • trigger_min/max:0.5s / 346.1s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 23.0s

Stack Uptimes

  • sinful_revelation_1:7.07%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 1.4 0.0 92.8sec 90.6sec 9.9sec 4.72% 0.00% 0.0 (0.0) 1.4

Buff Details

  • buff initial source:Necrolord_Marileth
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.1s / 313.2s
  • trigger_min/max:1.8s / 313.2s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 19.9s

Stack Uptimes

  • sinful_revelation_1:4.73%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 1.4 0.0 92.5sec 89.5sec 9.9sec 4.57% 0.00% 0.0 (0.0) 1.3

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:16.4s / 316.6s
  • trigger_min/max:1.8s / 316.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 19.6s

Stack Uptimes

  • sinful_revelation_1:4.57%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Touch of the Magi 6.2 0.0 51.5sec 51.6sec 7.9sec 16.47% 0.00% 0.0 (0.0) 6.1

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.3s / 66.9s
  • trigger_min/max:47.2s / 66.9s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 8.0s

Stack Uptimes

  • touch_of_the_magi_1:16.47%

Spelldata

  • id:210824
  • name:Touch of the Magi
  • tooltip:Will explode for $w1 Arcane damage upon expiration.
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Touch of the Magi 7.0 0.0 45.6sec 45.7sec 7.9sec 18.49% 0.00% 0.0 (0.0) 6.8

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.3s / 56.3s
  • trigger_min/max:34.7s / 56.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • touch_of_the_magi_1:18.49%

Spelldata

  • id:210824
  • name:Touch of the Magi
  • tooltip:Will explode for $w1 Arcane damage upon expiration.
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Touch of the Magi 7.0 0.0 45.7sec 45.8sec 7.9sec 18.43% 0.00% 0.0 (0.0) 6.8

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.3s / 56.4s
  • trigger_min/max:34.7s / 56.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • touch_of_the_magi_1:18.43%

Spelldata

  • id:210824
  • name:Touch of the Magi
  • tooltip:Will explode for $w1 Arcane damage upon expiration.
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Touch of the Magi 7.0 0.0 45.7sec 45.8sec 7.9sec 18.47% 0.00% 0.0 (0.0) 6.8

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.3s / 56.4s
  • trigger_min/max:34.7s / 56.4s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 8.0s

Stack Uptimes

  • touch_of_the_magi_1:18.47%

Spelldata

  • id:210824
  • name:Touch of the Magi
  • tooltip:Will explode for $w1 Arcane damage upon expiration.
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Touch of the Magi 7.0 0.0 45.6sec 45.7sec 7.9sec 18.46% 0.00% 0.0 (0.0) 6.8

Buff Details

  • buff initial source:NightFae_Koraylon
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.3s / 56.4s
  • trigger_min/max:34.7s / 56.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • touch_of_the_magi_1:18.46%

Spelldata

  • id:210824
  • name:Touch of the Magi
  • tooltip:Will explode for $w1 Arcane damage upon expiration.
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Touch of the Magi 6.1 0.0 52.1sec 52.2sec 7.9sec 16.25% 0.00% 0.0 (0.0) 6.0

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.1s / 66.5s
  • trigger_min/max:47.2s / 66.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • touch_of_the_magi_1:16.25%

Spelldata

  • id:210824
  • name:Touch of the Magi
  • tooltip:Will explode for $w1 Arcane damage upon expiration.
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Touch of the Magi 6.2 0.0 51.1sec 51.2sec 7.9sec 16.52% 0.00% 0.0 (0.0) 6.1

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.1s / 69.4s
  • trigger_min/max:46.3s / 69.4s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 8.0s

Stack Uptimes

  • touch_of_the_magi_1:16.52%

Spelldata

  • id:210824
  • name:Touch of the Magi
  • tooltip:Will explode for $w1 Arcane damage upon expiration.
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Touch of the Magi 6.1 0.0 52.3sec 52.4sec 7.9sec 16.17% 0.00% 0.0 (0.0) 6.0

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.1s / 68.5s
  • trigger_min/max:46.7s / 68.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • touch_of_the_magi_1:16.17%

Spelldata

  • id:210824
  • name:Touch of the Magi
  • tooltip:Will explode for $w1 Arcane damage upon expiration.
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Touch of the Magi 6.1 0.0 52.3sec 52.4sec 7.9sec 16.17% 0.00% 0.0 (0.0) 6.0

Buff Details

  • buff initial source:Kyrian_Forgelite
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.1s / 68.5s
  • trigger_min/max:46.7s / 68.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • touch_of_the_magi_1:16.17%

Spelldata

  • id:210824
  • name:Touch of the Magi
  • tooltip:Will explode for $w1 Arcane damage upon expiration.
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Touch of the Magi 6.2 0.0 51.5sec 51.6sec 7.9sec 16.42% 0.00% 0.0 (0.0) 6.1

Buff Details

  • buff initial source:Necrolord_Marileth
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.1s / 68.2s
  • trigger_min/max:46.5s / 68.2s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 8.0s

Stack Uptimes

  • touch_of_the_magi_1:16.42%

Spelldata

  • id:210824
  • name:Touch of the Magi
  • tooltip:Will explode for $w1 Arcane damage upon expiration.
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Touch of the Magi 6.2 0.0 51.5sec 51.6sec 7.9sec 16.41% 0.00% 0.0 (0.0) 6.1

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.1s / 68.2s
  • trigger_min/max:46.3s / 68.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • touch_of_the_magi_1:16.41%

Spelldata

  • id:210824
  • name:Touch of the Magi
  • tooltip:Will explode for $w1 Arcane damage upon expiration.
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by $s1%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by $1490s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by $w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by $113746s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Statistics & Data Analysis

Fight Length
Fluffy_Pillow Fight Length
Count 1319
Mean 299.94
Minimum 240.20
Maximum 359.96
Spread ( max - min ) 119.76
Range [ ( max - min ) / 2 * 100% ] 19.96%
DPS
Fluffy_Pillow Damage Per Second
Count 1319
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Fluffy_Pillow Priority Target Damage Per Second
Count 1319
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Fluffy_Pillow Damage Per Second (Effective)
Count 1319
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Fluffy_Pillow Damage
Count 1319
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Fluffy_Pillow Damage Taken Per Second
Count 1319
Mean 42300.41
Minimum 40483.44
Maximum 44617.98
Spread ( max - min ) 4134.53
Range [ ( max - min ) / 2 * 100% ] 4.89%
Standard Deviation 705.7002
5th Percentile 41173.97
95th Percentile 43511.28
( 95th Percentile - 5th Percentile ) 2337.31
Mean Distribution
Standard Deviation 19.4311
95.00% Confidence Interval ( 42262.33 - 42338.50 )
Normalized 95.00% Confidence Interval ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 11
0.1% Error 1070
0.1 Scale Factor Error with Delta=300 4252
0.05 Scale Factor Error with Delta=300 17006
0.01 Scale Factor Error with Delta=300 425133
HPS
Fluffy_Pillow Healing Per Second
Count 1319
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Fluffy_Pillow Healing Per Second (Effective)
Count 1319
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Fluffy_Pillow Heal
Count 1319
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Fluffy_Pillow Healing Taken Per Second
Count 1319
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Fluffy_Pillow Theck-Meloree Index
Count 1319
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Fluffy_PillowTheck-Meloree Index (Effective)
Count 1319
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Fluffy_Pillow Max Spike Value
Count 228
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (63) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 15218336 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 1071 1071 1071
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="Fluffy_Pillow"
source=default
spec=unknown
level=63
race=humanoid
role=tank
position=front
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

enemy2 : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
25296.8 0.0 Health 0.00% 0.0 100.0% 100%
Talents
  • 15: None
  • 25: None
  • 30: None
  • 35: None
  • 40: None
  • 45: None
  • 50: None
  • Talent Calculator

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 0.8 0.0 0.0sec 0.0sec 53.4sec 12.62% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 150.2s

Stack Uptimes

  • Health Decade (0 - 10)_1:12.63%
Health Decade (10 - 20) 0.9 0.0 0.0sec 0.0sec 29.1sec 8.82% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 45.4s

Stack Uptimes

  • Health Decade (10 - 20)_1:8.82%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 33.8sec 11.21% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 44.2s

Stack Uptimes

  • Health Decade (20 - 30)_1:11.21%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 36.7sec 12.38% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:19.7s / 49.3s

Stack Uptimes

  • Health Decade (30 - 40)_1:12.38%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 35.0sec 11.81% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:23.5s / 51.0s

Stack Uptimes

  • Health Decade (40 - 50)_1:11.81%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 34.0sec 11.49% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:29.3s / 42.4s

Stack Uptimes

  • Health Decade (50 - 60)_1:11.49%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 40.1sec 13.53% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:28.7s / 48.6s

Stack Uptimes

  • Health Decade (60 - 70)_1:13.53%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 31.4sec 10.60% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:14.2s / 48.5s

Stack Uptimes

  • Health Decade (70 - 80)_1:10.60%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 12.6sec 4.25% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:6.4s / 22.8s

Stack Uptimes

  • Health Decade (80 - 90)_1:4.25%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 13.2sec 3.29% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:8.1s / 300.0s

Stack Uptimes

  • Health Decade (90 - 100)_1:3.29%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by $s1%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by $1490s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by $w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by $113746s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Deaths

death count 2344
death count pct 175.58
avg death time 299.80
min death time 246.35
max death time 358.98
dmg taken 8119939.48

Statistics & Data Analysis

Fight Length
enemy2 Fight Length
Count 1319
Mean 299.94
Minimum 240.20
Maximum 359.96
Spread ( max - min ) 119.76
Range [ ( max - min ) / 2 * 100% ] 19.96%
DPS
enemy2 Damage Per Second
Count 1319
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
enemy2 Priority Target Damage Per Second
Count 1319
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
enemy2 Damage Per Second (Effective)
Count 1319
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
enemy2 Damage
Count 1319
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
enemy2 Damage Taken Per Second
Count 1319
Mean 27089.46
Minimum 26065.95
Maximum 28224.31
Spread ( max - min ) 2158.36
Range [ ( max - min ) / 2 * 100% ] 3.98%
Standard Deviation 390.5389
5th Percentile 26450.41
95th Percentile 27791.30
( 95th Percentile - 5th Percentile ) 1340.90
Mean Distribution
Standard Deviation 10.7533
95.00% Confidence Interval ( 27068.39 - 27110.54 )
Normalized 95.00% Confidence Interval ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 8
0.1% Error 799
0.1 Scale Factor Error with Delta=300 1303
0.05 Scale Factor Error with Delta=300 5209
0.01 Scale Factor Error with Delta=300 130201
HPS
enemy2 Healing Per Second
Count 1319
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
enemy2 Healing Per Second (Effective)
Count 1319
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
enemy2 Heal
Count 1319
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
enemy2 Healing Taken Per Second
Count 1319
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
enemy2 Theck-Meloree Index
Count 1319
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
enemy2Theck-Meloree Index (Effective)
Count 1319
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
enemy2 Max Spike Value
Count 228
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (63) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 8613884 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 1071 1071 1071
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="enemy2"
source=default
spec=unknown
level=63
race=humanoid
role=tank
position=front
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

enemy3 : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
27062.6 0.0 Health 0.00% 0.0 100.0% 100%
Talents
  • 15: None
  • 25: None
  • 30: None
  • 35: None
  • 40: None
  • 45: None
  • 50: None
  • Talent Calculator

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 0.7 0.0 0.0sec 0.0sec 55.2sec 12.57% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.4s / 155.5s

Stack Uptimes

  • Health Decade (0 - 10)_1:12.62%
Health Decade (10 - 20) 0.9 0.0 0.0sec 0.0sec 30.0sec 8.95% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 44.2s

Stack Uptimes

  • Health Decade (10 - 20)_1:8.97%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 35.0sec 11.64% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:1.5s / 46.8s

Stack Uptimes

  • Health Decade (20 - 30)_1:11.64%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 37.6sec 12.70% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:20.5s / 50.4s

Stack Uptimes

  • Health Decade (30 - 40)_1:12.70%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 36.2sec 12.24% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:24.4s / 53.1s

Stack Uptimes

  • Health Decade (40 - 50)_1:12.24%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 36.0sec 12.15% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 42.9s

Stack Uptimes

  • Health Decade (50 - 60)_1:12.15%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 41.2sec 13.93% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:25.9s / 49.2s

Stack Uptimes

  • Health Decade (60 - 70)_1:13.93%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 27.0sec 9.12% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:10.8s / 48.0s

Stack Uptimes

  • Health Decade (70 - 80)_1:9.12%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 10.3sec 3.49% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:4.5s / 16.4s

Stack Uptimes

  • Health Decade (80 - 90)_1:3.49%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 13.0sec 3.21% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:8.1s / 300.0s

Stack Uptimes

  • Health Decade (90 - 100)_1:3.21%
Sinful Revelation 10.0 5.3 29.2sec 18.5sec 12.3sec 40.82% 0.00% 5.3 (5.3) 9.6

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 131.3s
  • trigger_min/max:0.8s / 131.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.2s

Stack Uptimes

  • sinful_revelation_1:40.82%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 9.8 5.1 29.6sec 19.0sec 12.3sec 40.23% 0.00% 5.1 (5.1) 9.4

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 129.1s
  • trigger_min/max:0.1s / 125.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 53.7s

Stack Uptimes

  • sinful_revelation_1:40.23%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 9.9 5.1 29.5sec 18.9sec 12.3sec 40.36% 0.00% 5.1 (5.1) 9.4

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 130.4s
  • trigger_min/max:0.2s / 123.9s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 57.3s

Stack Uptimes

  • sinful_revelation_1:40.36%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 9.8 5.0 29.6sec 19.0sec 12.2sec 39.99% 0.00% 5.0 (5.0) 9.4

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 132.1s
  • trigger_min/max:0.2s / 120.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 51.9s

Stack Uptimes

  • sinful_revelation_1:39.99%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 9.9 5.1 29.4sec 18.9sec 12.3sec 40.36% 0.00% 5.1 (5.1) 9.5

Buff Details

  • buff initial source:NightFae_Koraylon
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 174.8s
  • trigger_min/max:0.2s / 142.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 63.2s

Stack Uptimes

  • sinful_revelation_1:40.36%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 10.0 5.3 29.1sec 18.5sec 12.4sec 41.06% 0.00% 5.3 (5.3) 9.6

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 161.1s
  • trigger_min/max:0.8s / 161.1s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 63.7s

Stack Uptimes

  • sinful_revelation_1:41.06%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 9.9 5.3 29.3sec 18.5sec 12.4sec 40.91% 0.00% 5.3 (5.3) 9.5

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 135.3s
  • trigger_min/max:0.8s / 135.3s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 52.4s

Stack Uptimes

  • sinful_revelation_1:40.91%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 9.6 4.8 30.0sec 19.5sec 12.2sec 39.19% 0.00% 4.8 (4.8) 9.2

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 142.3s
  • trigger_min/max:0.8s / 142.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 52.9s

Stack Uptimes

  • sinful_revelation_1:39.19%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 9.7 4.8 29.9sec 19.5sec 12.2sec 39.37% 0.00% 4.8 (4.8) 9.3

Buff Details

  • buff initial source:Kyrian_Forgelite
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 125.3s
  • trigger_min/max:0.8s / 125.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 50.7s

Stack Uptimes

  • sinful_revelation_1:39.37%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 10.0 5.3 29.1sec 18.5sec 12.4sec 41.14% 0.00% 5.3 (5.3) 9.6

Buff Details

  • buff initial source:Necrolord_Marileth
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 117.4s
  • trigger_min/max:0.8s / 112.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 55.5s

Stack Uptimes

  • sinful_revelation_1:41.14%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 10.0 5.2 29.1sec 18.5sec 12.3sec 40.83% 0.00% 5.2 (5.2) 9.5

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 166.8s
  • trigger_min/max:0.8s / 166.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 48.0s

Stack Uptimes

  • sinful_revelation_1:40.83%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by $s1%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by $1490s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by $w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by $113746s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Deaths

death count 2344
death count pct 175.58
avg death time 299.80
min death time 246.35
max death time 358.98
dmg taken 8689428.09

Statistics & Data Analysis

Fight Length
enemy3 Fight Length
Count 1319
Mean 299.94
Minimum 240.20
Maximum 359.96
Spread ( max - min ) 119.76
Range [ ( max - min ) / 2 * 100% ] 19.96%
DPS
enemy3 Damage Per Second
Count 1319
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
enemy3 Priority Target Damage Per Second
Count 1319
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
enemy3 Damage Per Second (Effective)
Count 1319
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
enemy3 Damage
Count 1319
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
enemy3 Damage Taken Per Second
Count 1319
Mean 28992.16
Minimum 27885.37
Maximum 30188.73
Spread ( max - min ) 2303.36
Range [ ( max - min ) / 2 * 100% ] 3.97%
Standard Deviation 403.4643
5th Percentile 28322.34
95th Percentile 29699.64
( 95th Percentile - 5th Percentile ) 1377.29
Mean Distribution
Standard Deviation 11.1092
95.00% Confidence Interval ( 28970.39 - 29013.93 )
Normalized 95.00% Confidence Interval ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 8
0.1% Error 744
0.1 Scale Factor Error with Delta=300 1390
0.05 Scale Factor Error with Delta=300 5559
0.01 Scale Factor Error with Delta=300 138962
HPS
enemy3 Healing Per Second
Count 1319
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
enemy3 Healing Per Second (Effective)
Count 1319
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
enemy3 Heal
Count 1319
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
enemy3 Healing Taken Per Second
Count 1319
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
enemy3 Theck-Meloree Index
Count 1319
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
enemy3Theck-Meloree Index (Effective)
Count 1319
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
enemy3 Max Spike Value
Count 228
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (63) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 8249429 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 1071 1071 1071
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="enemy3"
source=default
spec=unknown
level=63
race=humanoid
role=tank
position=front
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Execute

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Count

Average count of impacts per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Type

Direct or Periodic damage.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Buff Benefit

The percentage of times the buff had a actual benefit for its mainly intended purpose, eg. damage buffed / spell executes.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

Uptime Average Duration

The average duration of an instance of the tracked uptime.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.